From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006374000
  • symbol?:
  • description?: phage infection protein

      descriptions from strain specific annotations:

    • phage infection protein
    • ABC transporter
    • phage infection protein, putative
    • yhgE/Pip C-terminal domain protein
    • yhgE/Pip N-terminal domain protein
    • putative phage infection protein
    • bacteriophage infection protein
    • membrane protein
  • strand?: -
  • coordinates?: 6411808..6414789
  • synteny block?: BlockID0050830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2582
    08BA02176:
    C248_2711
    11819-97:
    MS7_2648
    71193:
    ST398NM01_2693
    ECT-R 2:
    ECTR2_2497
    ED133:
    SAOV_2692c
    ED98:
    SAAV_2713
    HO 5096 0412:
    SAEMRSA15_25480
    JH1:
    SaurJH1_2723
    JH9:
    SaurJH9_2667
    JKD6008:
    SAA6008_02702
    JKD6159:
    SAA6159_02539
    LGA251:
    SARLGA251_24150
    M013:
    M013TW_2624
    MRSA252:
    SAR2722
    MSHR1132:
    SAMSHR1132_24670
    MSSA476:
    SAS2529
    Mu3:
    SAHV_2627
    Mu50:
    SAV2643
    MW2:
    MW2564
    RF122:
    SAB2518c
    ST398:
    SAPIG2693
    T0131:
    SAT0131_02910
    TCH60:
    HMPREF0772_10544
    TW20:
    SATW20_27810
    USA300_TCH1516:
    USA300HOU_2643
    VC40:
    SAVC_12095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
    N315            --MKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
    NCTC8325        --MKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
    Newman          MTMKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
    USA300_FPR3757  --MKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
                      **********************************************************

    COL             NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
    N315            NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
    NCTC8325        NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
    Newman          NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
    USA300_FPR3757  NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
                    ************************************************************

    COL             EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
    N315            EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
    NCTC8325        EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
    Newman          EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
    USA300_FPR3757  EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
                    ************************************************************

    COL             AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
    N315            AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
    NCTC8325        AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
    Newman          AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
    USA300_FPR3757  AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
                    ************************************************************

    COL             GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
    N315            GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
    NCTC8325        GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
    Newman          GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
    USA300_FPR3757  GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
                    ************************************************************

    COL             IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
    N315            IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
    NCTC8325        IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
    Newman          IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
    USA300_FPR3757  IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
                    ************************************************************

    COL             SAPAAGNGVASTPPSAPSGDTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFVDIT
    N315            SSPAAGNGVASTPPSAPSGDTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFADIT
    NCTC8325        SAPAAGNGVASTPPSAPSGDTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFVDIT
    Newman          SAPAAGNGVASTPPSAPSGDTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFVDIT
    USA300_FPR3757  SAPAAGNGVASTPPSAPSGDTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFVDIT
                    *:******************************************************.***

    COL             TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
    N315            TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
    NCTC8325        TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
    Newman          TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
    USA300_FPR3757  TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
                    ************************************************************

    COL             SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
    N315            SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
    NCTC8325        SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
    Newman          SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
    USA300_FPR3757  SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
                    ************************************************************

    COL             LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
    N315            LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
    NCTC8325        LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
    Newman          LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
    USA300_FPR3757  LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
                    ************************************************************

    COL             LNKGQTALSNVQSKLNTIDQVINSGQAILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
    N315            LNKGQTALSNVQSKLNTIDQVINSGQAILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
    NCTC8325        LNKGQTALSNVQSKLNTIDQVINSGQAILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
    Newman          LNKGQTALSNVQSKLNTIDQVINSGQAILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
    USA300_FPR3757  LNKGQTALSNVQSKLNTIDQVINSGQAILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
                    ************************************************************

    COL             FSKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
    N315            FPKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
    NCTC8325        FSKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
    Newman          FSKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
    USA300_FPR3757  FSKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
                    *.**********************************************************

    COL             ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
    N315            ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
    NCTC8325        ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
    Newman          ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
    USA300_FPR3757  ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
                    ************************************************************

    COL             KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLESVLTTRQVFLGKAGF
    N315            KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLESVLTTRQVFLGKAGF
    NCTC8325        KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLESVLTTRQVFLGKAGF
    Newman          KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLESVLTTRQVFLGKAGF
    USA300_FPR3757  KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLESVLTTRQVFLGKAGF
                    ************************************************************

    COL             FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
    N315            FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
    NCTC8325        FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
    Newman          FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
    USA300_FPR3757  FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
                    ************************************************************

    COL             IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
    N315            IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
    NCTC8325        IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
    Newman          IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
    USA300_FPR3757  IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
                    ************************************************************

    COL             LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
    N315            LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
    NCTC8325        LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
    Newman          LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
    USA300_FPR3757  LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
                    ***********************************