From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006379000
  • symbol?: sasF
  • description?: cell wall anchor domain-containing protein

      descriptions from strain specific annotations:

    • cell wall anchor domain-containing protein
    • LPXTG cell wall surface anchor family protein
    • cell-wall-anchored protein SasF (LPXAG motif)
    • LPXTG-motif cell wall anchor domain-containing protein
    • surface anchored protein
    • putative surface anchored protein
    • LPXTG family cell wall surface anchor protein
    • putative LPXAG surface protein
    • serine-rich glycoprotein adhesin SraP
    • putative cell-wall-anchored protein SasF(LPXAG motif)
  • strand?: -
  • coordinates?: 6419579..6421147
  • synteny block?: BlockID0050870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2585 (sasF)
    08BA02176:
    C248_2714 (sasF)
    11819-97:
    MS7_2651 (sasF)
    71193:
    ST398NM01_2696
    ECT-R 2:
    ECTR2_2500
    ED133:
    SAOV_2697c
    ED98:
    SAAV_2716
    HO 5096 0412:
    SAEMRSA15_25510 (sasF)
    JH1:
    SaurJH1_2726
    JH9:
    SaurJH9_2670
    JKD6008:
    SAA6008_02705 (sasF)
    JKD6159:
    SAA6159_02542 (sasF)
    LGA251:
    SARLGA251_24180 (sasF)
    M013:
    M013TW_2627
    MRSA252:
    SAR2725 (sasF)
    MSHR1132:
    SAMSHR1132_24700
    MSSA476:
    SAS2532
    Mu3:
    SAHV_2630
    Mu50:
    SAV2646
    MW2:
    MW2567
    RF122:
    SAB2521c
    ST398:
    SAPIG2696
    T0131:
    SAT0131_02914
    TCH60:
    HMPREF0772_10541 (sraP)
    TW20:
    SATW20_27840 (sasF)
    USA300_TCH1516:
    USA300HOU_2646 (sasF)
    VC40:
    SAVC_12110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEITKEILSKQDLLDKVD
    N315            MAKYRGKPFQLYVKLSCSTMMASSIILTNILPYDAQAASEKDTEISKEILSKQDLLDKVD
    NCTC8325        MAKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEITKEILSKQDLLDKVD
    Newman          MAKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEITKEILSKQDLLDKVD
    USA300_FPR3757  MAKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEITKEILSKQDLLDKVD
                    **********************:**********************:**************

    COL             KAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDSKDNKSSHTEMNGQSD
    N315            KAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDSKENKSSHTEMNGQSD
    NCTC8325        KAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDSKDNKSSHTEMNGQSD
    Newman          KAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDSKDNKSSHTEMNGQSD
    USA300_FPR3757  KAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDSKDNKSSHTEMNGQSD
                    ***************** ****************************:*************

    COL             IDSKLDQLLKDLNEVSSNVDRGQQSGEDDLNAMKNDMSQTATTKHGEKDDKNDEAMVNKA
    N315            IDSKLDQLLKDLNEVSSNVDRGQQSGEDDLNAMKNDMSQTATTKYGEKDDKNDEAMVNKA
    NCTC8325        IDSKLDQLLKDLNEVSSNVDRGQQSGEDDLNAMKNDMSQTATTKHGEKDDKNDEAMVNKA
    Newman          IDSKLDQLLKDLNEVSSNVDRGQQSGEDDLNAMKNDMSQTATTKHGEKDDKNDEAMVNKG
    USA300_FPR3757  IDSKLDQLLKDLNEVSSNVDRGQQSGEDDLNAMKNDMSQTATTKHGEKDDKNDEAMVNKA
                    ********************************************:**************.

    COL             LEDLDHLNQQIHKSKDASKDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLNKFLSNEENQ
    N315            LEDLDHLNQQIHKSKDALKDASKDPAVSTTDSNHEVAKTPNNDGSGHVVLNKFLSNEENQ
    NCTC8325        LEDLDHLNQQIHKSKDASKDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLNKFLSNEENQ
    Newman          LEDLDHLNQQIHKSKDASKDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLNKFLSNEENQ
    USA300_FPR3757  LEDLDHLNQQIHKSKDASKDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLNKFLSNEENQ
                    ***************** **:*:********.****************************

    COL             SHSNRLTDKLQGSDKINHAMIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKS
    N315            SHSNQLTDKLQGSDKINHAMIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKS
    NCTC8325        SHSNRLTDKLQGSDKINHAMIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKS
    Newman          SHSNRLTDKLQGSDKINHAMIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKS
    USA300_FPR3757  SHSNRLTDKLQGSDKINHAMIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKS
                    ****:*******************************************************

    COL             DLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKT
    N315            DLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKT
    NCTC8325        DLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKT
    Newman          DLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKT
    USA300_FPR3757  DLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKT
                    *********************************************** ************

    COL             DQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTN
    N315            DQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTN
    NCTC8325        DQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTN
    Newman          DQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTN
    USA300_FPR3757  DQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTN
                    ************************************************************

    COL             KGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLAD
    N315            KGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLAD
    NCTC8325        KGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLAD
    Newman          KGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLAD
    USA300_FPR3757  KGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLAD
                    ************************************************************

    COL             LITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNK
    N315            LITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNK
    NCTC8325        LITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNK
    Newman          LITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNK
    USA300_FPR3757  LITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNK
                    ************************************************************

    COL             NGKTTDLNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGKGNGLLSGLLNADGNVSLPKA
    N315            NGKTTDLNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGKGNGLLSGLLNADGNVSLPKA
    NCTC8325        NGKTTDLNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGKGNGLLSGLLNADGNVSLPKA
    Newman          NGKTTDLNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGKGNGLLSGLLNADGNVSLPKA
    USA300_FPR3757  NGKTTDLNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGKGNGLLSGLLNADGNVSLPKA
                    ******************:*****************************************

    COL             GETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
    N315            GETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
    NCTC8325        GETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
    Newman          GETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
    USA300_FPR3757  GETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
                    ***********************************