From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006380000
  • symbol?: gtfB
  • description?: accessory Sec system glycosylation chaperone GtfB

      descriptions from strain specific annotations:

    • accessory Sec system glycosylation chaperone GtfB
    • accessory Sec system glycosyltransferase GtfB
    • alpha-glucosyltransferase
    • GftB: Glycosyl transferase, family 8
    • surface protein Pls
  • strand?: -
  • coordinates?: 6421755..6423155
  • synteny block?: BlockID0050880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2586
    08BA02176:
    C248_2715
    11819-97:
    MS7_2652 (gtfB)
    71193:
    ST398NM01_2697
    ECT-R 2:
    ECTR2_2501
    ED133:
    SAOV_2698c
    ED98:
    SAAV_2717
    HO 5096 0412:
    SAEMRSA15_25520
    JH1:
    SaurJH1_2727
    JH9:
    SaurJH9_2671
    JKD6008:
    SAA6008_02706
    JKD6159:
    SAA6159_02543
    LGA251:
    SARLGA251_24190
    M013:
    M013TW_2628
    MRSA252:
    SAR2726
    MSHR1132:
    SAMSHR1132_24710
    MSSA476:
    SAS2533
    Mu3:
    SAHV_2631
    Mu50:
    SAV2647
    MW2:
    MW2568
    RF122:
    SAB2522c
    ST398:
    SAPIG2697
    T0131:
    SAT0131_02915
    TCH60:
    HMPREF0772_10540 (gtfB)
    TW20:
    SATW20_27850
    USA300_TCH1516:
    USA300HOU_2647
    VC40:
    SAVC_12115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
    N315            MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
    NCTC8325        MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
    Newman          MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
    USA300_FPR3757  MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
                    ************************************************************

    COL             RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
    N315            RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
    NCTC8325        RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
    Newman          RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
    USA300_FPR3757  RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
                    ************************************************************

    COL             YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
    N315            YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
    NCTC8325        YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
    Newman          YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
    USA300_FPR3757  YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
                    ************************************************************

    COL             ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
    N315            VLFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
    NCTC8325        ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
    Newman          ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
    USA300_FPR3757  ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
                    .***********************************************************

    COL             KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
    N315            KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
    NCTC8325        KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
    Newman          KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
    USA300_FPR3757  KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
                    ************************************************************

    COL             KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
    N315            KVLVETLPDFNFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
    NCTC8325        KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
    Newman          KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
    USA300_FPR3757  KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
                    **********:*************************************************

    COL             NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
    N315            NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
    NCTC8325        NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
    Newman          NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
    USA300_FPR3757  NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
                    ************************************************************

    COL             QQFRDALLAQKAHAHEISREQFEQVFKQALES
    N315            QQFRDALLAQKAHAHEISREQFEQVFKQALES
    NCTC8325        QQFRDALLAQKAHAHEISREQFEQVFKQALES
    Newman          QQFRDALLAQKAHAHEISREQFEQVFKQALES
    USA300_FPR3757  QQFRDALLAQKAHAHEISREQFEQVFKQALES
                    ********************************