From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006381000
  • symbol?: gtfA
  • description?: accessory Sec system glycosyltransferase GtfA

      descriptions from strain specific annotations:

    • accessory Sec system glycosyltransferase GtfA
    • glycosyl transferase, group 1 family protein
    • putative glycosyl transferase
    • glycosyltransferase
    • Poly(glycerol-phosphate) alpha-glucosyltransferase GftA
    • accessory Sec system glycosylation protein GtfA
    • glycoside hydrolase family protein
    • glycosyl transferases group 1 family protein
    • lipopolysaccharide biosynthesis protein
    • Poly(Glycerol-phosphate) alpha-glucosyltransferase
  • strand?: -
  • coordinates?: 6423148..6424656
  • synteny block?: BlockID0050890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2587 (gftA)
    08BA02176:
    C248_2716
    11819-97:
    MS7_2653 (gtfA)
    71193:
    ST398NM01_2698
    ECT-R 2:
    ECTR2_2502
    ED133:
    SAOV_2699c
    ED98:
    SAAV_2718
    HO 5096 0412:
    SAEMRSA15_25530
    JH1:
    SaurJH1_2728
    JH9:
    SaurJH9_2672
    JKD6008:
    SAA6008_02707
    JKD6159:
    SAA6159_02544
    LGA251:
    SARLGA251_24200
    M013:
    M013TW_2629
    MRSA252:
    SAR2727
    MSHR1132:
    SAMSHR1132_24720
    MSSA476:
    SAS2534
    Mu3:
    SAHV_2632
    Mu50:
    SAV2648
    MW2:
    MW2569
    RF122:
    SAB2523c
    ST398:
    SAPIG2698
    T0131:
    SAT0131_02916
    TCH60:
    HMPREF0772_10539 (gtfA)
    TW20:
    SATW20_27860
    USA300_TCH1516:
    USA300HOU_2648
    VC40:
    SAVC_12120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ
    N315            MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ
    NCTC8325        MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ
    Newman          MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ
    USA300_FPR3757  MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ
                    ************************************************************

    COL             EVIWLYQYFSDISLAPTTYTLDDIERELGHDISFRERNGKIVRLYFNGKSSFVTCYLQNE
    N315            EVIWLYQYFSDISIAPTTYTLDDIERELGHEISFRERNGKIVRLYFNGKSSFVTCYLQNE
    NCTC8325        EVIWLYQYFSDISLAPTTYTLDDIERELGHDISFRERNGKIVRLYFNGKSSFVTCYLQNE
    Newman          EVIWLYQYFSDISLAPTTYTLDDIERELGHDISFRERNGKIVRLYFNGKSSFVTCYLQNE
    USA300_FPR3757  EVIWLYQYFSDISLAPTTYTLDDIERELGHDISFRERNGKIVRLYFNGKSSFVTCYLQNE
                    *************:****************:*****************************

    COL             QKDIVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNQDGSIAYNEYID
    N315            QKDVVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNEDGSIAYNEYID
    NCTC8325        QKDIVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNQDGSIAYNEYID
    Newman          QKDIVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNQDGSIAYNEYID
    USA300_FPR3757  QKDIVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNQDGSIAYNEYID
                    ***:********************************************:***********

    COL             GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI
    N315            GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI
    NCTC8325        GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI
    Newman          GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI
    USA300_FPR3757  GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI
                    ************************************************************

    COL             HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY
    N315            HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY
    NCTC8325        HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY
    Newman          HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY
    USA300_FPR3757  HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY
                    ************************************************************

    COL             TIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS
    N315            TIPVGSIDALSYPKLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS
    NCTC8325        TIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS
    Newman          TIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS
    USA300_FPR3757  TIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS
                    *************.**********************************************

    COL             EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI
    N315            EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI
    NCTC8325        EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI
    Newman          EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI
    USA300_FPR3757  EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI
                    ************************************************************

    COL             GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQTPHDISYEVA
    N315            GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQAPHDISYEVA
    NCTC8325        GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQTPHDISYEVA
    Newman          GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQTPHDISYEVA
    USA300_FPR3757  GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQTPHDISYEVA
                    **************************************************:*********

    COL             QQFMTQDIILKWETLVQEVLHD
    N315            QQFMTQDIILKWETLVQEVLHD
    NCTC8325        QQFMTQDIILKWETLVQEVLHD
    Newman          QQFMTQDIILKWETLVQEVLHD
    USA300_FPR3757  QQFMTQDIILKWETLVQEVLHD
                    **********************