From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006382000
  • symbol?: secA2
  • description?: accessory Sec system translocase SecA2

      descriptions from strain specific annotations:

    • accessory Sec system translocase SecA2
    • preprotein translocase subunit SecA
    • preprotein translocase SecA subunit-like protein
    • Protein export cytoplasm protein SecA2 ATPase RNA helicase
    • protein translocase subunit secA
    • Protein translocase subunit secA 2
    • pseudogene
    • Sec family Type I general secretory pathway protein SecA
  • strand?: -
  • coordinates?: 6424674..6427007
  • synteny block?: BlockID0050900
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2588 (secA)
    08BA02176:
    C248_2717
    11819-97:
    MS7_2654
    71193:
    ST398NM01_2699
    ECT-R 2:
    ECTR2_2503
    ED133:
    SAOV_2700c
    ED98:
    SAAV_2719
    HO 5096 0412:
    SAEMRSA15_25540
    JH1:
    SaurJH1_2729 (azi)
    JH9:
    SaurJH9_2673 (azi)
    JKD6008:
    SAA6008_02708 (secA2)
    JKD6159:
    SAA6159_02545 (secA2)
    LGA251:
    SARLGA251_24210
    M013:
    M013TW_2630
    MRSA252:
    SAR2728 (azi)
    MSHR1132:
    SAMSHR1132_24730
    MSSA476:
    SAS2535 (azi)
    Mu3:
    SAHV_2633
    Mu50:
    SAV2649 (azi)
    MW2:
    MW2570 (azi)
    RF122:
    SAB2524c
    ST398:
    SAPIG2699
    T0131:
    TCH60:
    HMPREF0772_10538 (secA)
    TW20:
    SATW20_27870
    USA300_TCH1516:
    USA300HOU_2649 (secA2)
    VC40:
    SAVC_12125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHKLDVTINELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVDTLDTL
    N315            MKHKLDVTINELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVDTLDTL
    NCTC8325        MKHKLDVTINELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVDTLDTL
    Newman          MKHKLDVTINELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVDTLDTL
    USA300_FPR3757  MKHKLDVTINELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVDTLDTL
                    ************************************************************

    COL             LPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSG
    N315            LPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSG
    NCTC8325        LPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSG
    Newman          LPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSG
    USA300_FPR3757  LPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSG
                    ************************************************************

    COL             KGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVDYEYQKGEKRNIYEHDIIYTT
    N315            KGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVDYEYQKGEKRNIYEHDIIYTT
    NCTC8325        KGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVDYEYQKGEKRNIYEHDIIYTT
    Newman          KGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVDYEYQKGEKRNIYEHDIIYTT
    USA300_FPR3757  KGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVDYEYQKGEKRNIYEHDIIYTT
                    ************************************************************

    COL             NGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHI
    N315            NGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHI
    NCTC8325        NGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHI
    Newman          NGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHI
    USA300_FPR3757  NGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHI
                    ************************************************************

    COL             VKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRA
    N315            VKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRA
    NCTC8325        VKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRA
    Newman          VKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRA
    USA300_FPR3757  VKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRA
                    ************************************************************

    COL             QYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATIT
    N315            QYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATIT
    NCTC8325        QYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATIT
    Newman          QYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATIT
    USA300_FPR3757  QYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATIT
                    ************************************************************

    COL             FQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDKAIQRIDEPDKVFRSVDEKNI
    N315            FQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQAPTDKAIQRIDEPDKVFRSVDEKNI
    NCTC8325        FQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDKAIQRIDEPDKVFRSVDEKNI
    Newman          FQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDKAIQRIDEPDKVFRSVDEKNI
    USA300_FPR3757  FQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDKAIQRIDEPDKVFRSVDEKNI
                    ***********************************.************************

    COL             AMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQ
    N315            AMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQ
    NCTC8325        AMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQ
    Newman          AMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQ
    USA300_FPR3757  AMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQ
                    ************************************************************

    COL             IGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSC
    N315            IGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSC
    NCTC8325        IGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSC
    Newman          IGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSC
    USA300_FPR3757  IGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSC
                    ************************************************************

    COL             IYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNRKVKQIVVKAQRISEEQGVKA
    N315            IYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNRKVKQIVVKAQRISEEQGVKA
    NCTC8325        IYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNRKVKQIVVKAQRISEEQGVKA
    Newman          IYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNRKVKQIVVKAQRISEEQGVKA
    USA300_FPR3757  IYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNRKVKQIVVKAQRISEEQGVKA
                    ************************************************************

    COL             REMANEFEKSISIQRDLVYEERNRVLEIDDAENQDFKALAKDVFEMFVNEEKVLTKSRVV
    N315            REMANEFEKSISIQRDLVYEERNRVLEIDDAENRDFKALAKDVFEMFVNEEKVLTKSRVV
    NCTC8325        REMANEFEKSISIQRDLVYEERNRVLEIDDAENQDFKALAKDVFEMFVNEEKVLTKSRVV
    Newman          REMANEFEKSISIQRDLVYEERNRVLEIDDAENQDFKALAKDVFEMFVNEEKVLTKSRVV
    USA300_FPR3757  REMANEFEKSISIQRDLVYEERNRVLEIDDAENQDFKALAKDVFEMFVNEEKVLTKSRVV
                    *********************************:**************************

    COL             EYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYNIFVQKVFL
    N315            EYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYNIFVQKVFL
    NCTC8325        EYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYNIFVQKVFL
    Newman          EYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYNIFVQKVFL
    USA300_FPR3757  EYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYNIFVQKVFL
                    ************************************************************

    COL             KAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIKKRMVKNICQ
    N315            KAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIKKRMVKNICQ
    NCTC8325        KAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIKKRMVKNICQ
    Newman          KAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIKKRMVKNICQ
    USA300_FPR3757  KAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIKKRMVKNICQ
                    ************************************************************

    COL             SMITFDKEGMPVIHFP
    N315            SMITFDKEGMPVIHFP
    NCTC8325        SMITFDKEGMPVIHFP
    Newman          SMITFDKEGMPVIHFP
    USA300_FPR3757  SMITFDKEGMPVIHFP
                    ****************