From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006387000
  • symbol?: asp1
  • description?: accessory Sec system protein Asp1

      descriptions from strain specific annotations:

    • accessory Sec system protein Asp1
    • accessory secretory protein Asp1
    • accessory Sec system asp1
    • pseudogene
  • strand?: -
  • coordinates?: 6429552..6431105
  • synteny block?: BlockID0050950
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2591 (asp1)
    08BA02176:
    C248_2720
    11819-97:
    MS7_2657 (asp1)
    71193:
    ST398NM01_2702
    ECT-R 2:
    ECTR2_2506
    ED133:
    SAOV_2703c
    ED98:
    HO 5096 0412:
    SAEMRSA15_25570
    JH1:
    SaurJH1_2732
    JH9:
    SaurJH9_2676
    JKD6008:
    SAA6008_02711
    JKD6159:
    SAA6159_02548
    LGA251:
    SARLGA251_24240
    M013:
    M013TW_2633
    MRSA252:
    SAR2731
    MSHR1132:
    SAMSHR1132_24760
    MSSA476:
    SAS2538
    Mu3:
    SAHV_2636
    Mu50:
    SAV2652
    MW2:
    MW2573
    RF122:
    SAB2527c
    ST398:
    SAPIG2702
    T0131:
    SAT0131_02921
    TCH60:
    HMPREF0772_10535 (asp1)
    TW20:
    SATW20_27900
    USA300_TCH1516:
    USA300HOU_2652
    VC40:
    SAVC_12140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYFIPAWYDDQRWWQDTTVPYYQLQNKTEFDDMISLMGMHLENDLDYQLIVLNHAPNLR
    N315            MKYFIPAWYDDQRWWQDTTVPYYQLQNKTEFDDMISLMGMHLENDLDYQLIVLNHAPNLR
    NCTC8325        MKYFIPAWYDDQRWWQDTTVPYYQLQNKTEFDDMISLMGMHLENDLDYQLIVLNHAPNLR
    Newman          MKYFIPAWYDDQRWWQDTTVPYYQLQNKTEFDDMISLMGMHLENDLDYQLIVLNHAPNLR
    USA300_FPR3757  MKYFIPAWYDDQRWWQDTTVPYYQLQNKTEFDDMISLMGMHLENDLDYQLIVLNHAPNLR
                    ************************************************************

    COL             TFLHRYDLYETKYSSVFDEIQGFSHHAPQAINYHHLKWPDDVEFVYTPYLLKCVTSEQTY
    N315            TFLHRYDLYETKYSSVFDEIQGFSHHAPQAINYHHLKWPDDVEFVYTPYLLKCVTSEQTY
    NCTC8325        TFLHRYDLYETKYSSVFDEIQGFSHHAPQAINYHHLKWPDDVEFVYTPYLLKCVTSEQTY
    Newman          TFLHRYDLYETKYSSVFDEIQGFSHHAPQAINYHHLKWPDDVEFVYTPYLLKCVTSEQTY
    USA300_FPR3757  TFLHRYDLYETKYSSVFDEIQGFSHHAPQAINYHHLKWPDDVEFVYTPYLLKCVTSEQTY
                    ************************************************************

    COL             TNIYFSQEGYSIWFEEFERDQLQRRYIFDDRGYLSAIRYFDDQGEASYQEYLTINGDCVL
    N315            TNIYFSQEGYSIWFEEFERDQLQRRYIFDDRGYLSAIRYFDDQGEASYQQYLTINGDCVL
    NCTC8325        TNIYFSQEGYSIWFEEFERDQLQRRYIFDDRGYLSAIRYFDDQGEASYQEYLTINGDCVL
    Newman          TNIYFSQEGYSIWFEEFERDQLQRRYIFDDRGYLSAIRYFDDQGEASYQEYLTINGDCVL
    USA300_FPR3757  TNIYFSQEGYSIWFEEFERDQLQRRYIFDDRGYLSAIRYFDDQGEASYQEYLTINGDCVL
                    *************************************************:**********

    COL             HEDLKNGRVTVSKRYQHHYQQTEYNNMAQLIEEKFQAMIAQQIHEDDHVIVASDARHNRQ
    N315            HEDLKNGRVTVSKRYQHHYQQTEYNNMAQLIEEKFQAMIAQQIHEDDHVIVASDARHNRQ
    NCTC8325        HEDLKNGRVTVSKRYQHHYQQTEYNNMAQLIEEKFQAMIAQQIHEDDHVIVASDARHNRQ
    Newman          HEDLKNGRVTVSKRYQHHYQQTEYNNMAQLIEEKFQAMIAQQIHEDDHVIVASDARHNRQ
    USA300_FPR3757  HEDLKNGRVTVSKRYQHHYQQTEYNNMAQLIEEKFQAMIAQQIHEDDHVIVASDARHNRQ
                    ************************************************************

    COL             IANHIPAKSLSYSFFKNRNETVSDEEYQSIVKNAHLIVDSVQLERDLISHQEKYQRENTM
    N315            IANHIPAKLLSYSFFKNRNETVSDEEYQSIVKNAHLIVDSMQLERDLISHQEKYQRENTM
    NCTC8325        IANHIPAKSLSYSFFKNRNETVSDEEYQSIVKNAHLIVDSVQLERDLISHQEKYQRENTM
    Newman          IANHIPAKSLSYSFFKNRNETVSDEEYQSIVKNAHLIVDSVQLERDLISHQEKYQRENTM
    USA300_FPR3757  IANHIPAKSLSYSFFKNRNETVSDEEYQSIVKNAHLIVDSVQLERDLISHQEKYQRENTM
                    ******** *******************************:*******************

    COL             IRITPFETRQSPNISSQLMETFIGVWIDGMSDADLQQMMQRLVDYIAQEDYYRLILLSRH
    N315            IRITPFETRQSPNISSQLMETFIGVWIDGMSDADLQQMMQRLVDYIAQEDYYRLILLSRH
    NCTC8325        IRITPFETRQSPNISSQLMETFIGVWIDGMSDADLQQMMQRLVDYIAQEDYYRLILLSRH
    Newman          IRITPFETRQSPNISSQLMETFIGVWIDGMSDADLQQMMQRLVDYIAQEDYYRLILLSRH
    USA300_FPR3757  IRITPFETRQSPNISSQLMETFIGVWIDGMSDADLQQMMQRLVDYIAQEDYYRLILLSRH
                    ************************************************************

    COL             QNDIPMWLRECITSVNEEYQAKQNADVNVSALMTPEDQDDIIAVKTIHAEHDVVEALRTL
    N315            QNDIPMWLRECITSVNEEYQAKQNADVNVSALMTPEDQDDIIAVKTIHAEHDVVEALRTL
    NCTC8325        QNDIPMWLRECITSVNEEYQAKQNADVNVSALMTPEDQDDIIAVKTIHAEHDVVEALRTL
    Newman          QNDIPMWLRECITSVNEEYQAKQNADVNVSALMTPEDQDDIIAVKTIHAEHDVVEALRTL
    USA300_FPR3757  QNDIPMWLRECITSVNEEYQAKQNADVNVSALMTPEDQDDIIAVKTIHAEHDVVEALRTL
                    ************************************************************

    COL             RLVIDMSKEPDLYLQISAISAGIPQINGQQTDYVSDYDNGRIINTVDELDDALNYYLFYL
    N315            RLVIDMSKEPDLYLQISAISAGIPQINGQQTDYVSDYDNGRIINTVDELDDALNYYLFYL
    NCTC8325        RLVIDMSKEPDLYLQISAISAGIPQINGQQTDYVSDYDNGRIINTVDELDDALNYYLFYL
    Newman          RLVIDMSKEPDLYLQISAISAGIPQINGQQTDYVSDYDNGRIINTVDELDDALNYYLFYL
    USA300_FPR3757  RLVIDMSKEPDLYLQISAISAGIPQINGQQTDYVSDYDNGRIINTVDELDDALNYYLFYL
                    ************************************************************

    COL             KNWNYAYAYSLKLIDAYASKNIINQLDELIEGENDAT
    N315            KNWNYAYAYSLKLIDAYASKNIINQLDELIEGENDAT
    NCTC8325        KNWNYAYAYSLKLIDAYASKNIINQLDELIEGENDAT
    Newman          KNWNYAYAYSLKLIDAYASKNIINQLDELIEGENDAT
    USA300_FPR3757  KNWNYAYAYSLKLIDAYASKNIINQLDELIEGENDAT
                    *************************************