From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006404000
  • symbol?:
  • description?: nitrilotriacetate monooxygenase component B-like protein

      descriptions from strain specific annotations:

    • nitrilotriacetate monooxygenase component B-like protein
    • putative flavin reductase
    • Flavin reductase domain protein, FMN-binding protein
    • conserved protein YwrF
    • FAD-dependent oxidoreductase
  • strand?: -
  • coordinates?: 6455406..6456017
  • synteny block?: BlockID0051110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2598
    08BA02176:
    C248_2729
    11819-97:
    MS7_2664
    71193:
    ST398NM01_2711
    ECT-R 2:
    ECTR2_2513
    ED133:
    SAOV_2711c
    ED98:
    SAAV_2731
    HO 5096 0412:
    SAEMRSA15_25660
    JH1:
    SaurJH1_2740
    JH9:
    SaurJH9_2683
    JKD6008:
    SAA6008_02719
    JKD6159:
    SAA6159_02555
    LGA251:
    SARLGA251_24330
    M013:
    M013TW_2642
    MRSA252:
    SAR2740
    MSHR1132:
    SAMSHR1132_24870
    MSSA476:
    SAS2545
    Mu3:
    SAHV_2643
    Mu50:
    SAV2659
    MW2:
    MW2579
    RF122:
    SAB2534c
    ST398:
    SAPIG2711
    T0131:
    SAT0131_02938 (arlR)
    TCH60:
    HMPREF0772_10527
    TW20:
    SATW20_27970
    USA300_TCH1516:
    USA300HOU_2659
    VC40:
    SAVC_12175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIA
    N315            MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMVAIA
    NCTC8325        MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIA
    Newman          MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIA
    USA300_FPR3757  MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIA
                    ********************************************************:***

    COL             VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTT
    N315            VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTGLSLLTSTT
    NCTC8325        VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTT
    Newman          VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTT
    USA300_FPR3757  VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTT
                    *************************************************** ********

    COL             IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
    N315            IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
    NCTC8325        IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
    Newman          IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
    USA300_FPR3757  IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
                    ************************************************************

    COL             VSRLAGNDYAKLGGIFTIKRPEK
    N315            VSRLAGNDYAKLGGIFTIKRPEK
    NCTC8325        VSRLAGNDYAKLGGIFTIKRPEK
    Newman          VSRLAGNDYAKLGGIFTIKRPEK
    USA300_FPR3757  VSRLAGNDYAKLGGIFTIKRPEK
                    ***********************