From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006406000
  • symbol?:
  • description?: N-acetyltransferase

      descriptions from strain specific annotations:

    • N-acetyltransferase
    • acetyltransferase
    • acetyltransferase, GNAT family protein
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • GNAT family acetyltransferase
    • N-acetyltransferase GCN5
  • strand?: -
  • coordinates?: 6456575..6457078
  • synteny block?: BlockID0051130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2600
    08BA02176:
    C248_2731
    11819-97:
    MS7_2666
    71193:
    ST398NM01_2713
    ECT-R 2:
    ECTR2_2515
    ED133:
    SAOV_2713c
    ED98:
    SAAV_2733
    HO 5096 0412:
    SAEMRSA15_25680
    JH1:
    SaurJH1_2742
    JH9:
    SaurJH9_2685
    JKD6008:
    SAA6008_02721
    JKD6159:
    SAA6159_02557
    LGA251:
    SARLGA251_24350
    M013:
    M013TW_2644
    MRSA252:
    SAR2742
    MSHR1132:
    SAMSHR1132_24890
    MSSA476:
    SAS2547
    Mu3:
    SAHV_2645
    Mu50:
    SAV2661
    MW2:
    MW2581
    RF122:
    SAB2536c
    ST398:
    SAPIG2713
    T0131:
    SAT0131_02940
    TCH60:
    HMPREF0772_10525
    TW20:
    SATW20_27990
    USA300_TCH1516:
    USA300HOU_2661
    VC40:
    SAVC_12185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVLRKVIMQDLDQIIALENIGFSPEEAATREALKLRIEQIQETFIVAEKNDEVIGYINGP
    N315            MVLRKVIMQDLDQIIALENIGFSPEEAATREALKLRIEQIQETFIVAEKNDEVIGYINGP
    NCTC8325        MVLRKVIMQDLDQIIALENIGFSPEEAATREALKLRIEQIQETFIVAEKNDEVIGYINGP
    Newman          MVLRKVIMQDLDQIIALENIGFSPEEAATREALKLRIEQIQETFIVAEKNDEVIGYINGP
    USA300_FPR3757  MVLRKVIMQDLDQIIALENIGFSPEEAATREALKLRIEQIQETFIVAEKNDEVIGYINGP
                    ************************************************************

    COL             VIKERYISDDLFKNVSTNNSEGGYISVLGLVVAPNYQGQGIAGRLLNYFETLAKNHHRHG
    N315            VIKERYISDDLFKNVSINNSEGGYISVLGLVVAPNYQGQGIAGRLLNYFETLAKNHHRHG
    NCTC8325        VIKERYISDDLFKNVSTNNSEGGYISVLGLVVAPNYQGQGIAGRLLNYFETLAKNHHRHG
    Newman          VIKERYISDDLFKNVSTNNSEGGYISVLGLVVAPNYQGQGIAGRLLNYFETLAKNHHRHG
    USA300_FPR3757  VIKERYISDDLFKNVSTNNSEGGYISVLGLVVAPNYQGQGIAGRLLNYFETLAKNHHRHG
                    **************** *******************************************

    COL             VTLTCRESLISFYEKYGYRNEGVSESCHGGIKWYNLVKNIKKDDEV
    N315            VTLTCRESLISFYEKYGYRNEGVSESCHGGIKWYNLVKNIKKDDEV
    NCTC8325        VTLTCRESLISFYEKYGYRNEGVSESCHGGIKWYNLVKNIKKDDEV
    Newman          VTLTCRESLISFYEKYGYRNEGVSESCHGGIKWYNLVKNIKKDDEV
    USA300_FPR3757  VTLTCRESLISFYEKYGYRNEGVSESCHGGIKWYNLVKNIKKDDEV
                    **********************************************