From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006412000
  • symbol?: icaD
  • description?: intercellular adhesion protein D

      descriptions from strain specific annotations:

    • intercellular adhesion protein D
    • Polysaccharide intercellular adhesin (PIA)biosynthesis protein IcaD
    • intercellular adhesion protein IcaD
    • intracellular adhesion protein D
  • strand?: +
  • coordinates?: 6462636..6462922
  • synteny block?: BlockID0051190
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2690 (icaD)
    N315:
    SA2460 (icaD)
    NCTC8325:
    Newman:
    NWMN_2566 (icaD)
    USA300_FPR3757:
    04-02981:
    SA2981_2606 (icaD)
    08BA02176:
    11819-97:
    MS7_2672 (icaD)
    71193:
    ECT-R 2:
    ED133:
    SAOV_2719
    ED98:
    SAAV_2739 (icaD)
    HO 5096 0412:
    SAEMRSA15_25740 (icaD)
    JH1:
    SaurJH1_2748
    JH9:
    SaurJH9_2691
    JKD6008:
    JKD6159:
    SAA6159_02563 (icaD)
    LGA251:
    SARLGA251_24410 (icaD)
    M013:
    M013TW_2650
    MRSA252:
    SAR2748 (icaD)
    MSHR1132:
    SAMSHR1132_24950
    MSSA476:
    SAS2553
    Mu3:
    SAHV_2651 (icaD)
    Mu50:
    SAV2667 (icaD)
    MW2:
    MW2587 (icaD)
    RF122:
    SAB2542 (icaD)
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10519 (icaD)
    TW20:
    SATW20_28050 (icaD)
    USA300_TCH1516:
    USA300HOU_2667 (icaD)
    VC40:
    SAVC_12215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA
    N315            MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA
    NCTC8325        MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA
    Newman          MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA
                    ************************************************************

    COL             LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
    N315            LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
    NCTC8325        LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
    Newman          LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
                    *****************************************