From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006430000
  • symbol?: hisH
  • description?: imidazole glycerol phosphate synthase subunit HisH

      descriptions from strain specific annotations:

    • imidazole glycerol phosphate synthase subunit HisH
    • Imidazole glycerol phosphate synthase amidotransferase subunit
    • imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
    • putative amidotransferase
  • strand?: -
  • coordinates?: 6472878..6473456
  • synteny block?: BlockID0051370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2699 (hisH)
    N315:
    SA2467 (hisH)
    NCTC8325:
    Newman:
    NWMN_2573 (hisH)
    USA300_FPR3757:
    04-02981:
    SA2981_2615 (hisH)
    08BA02176:
    C248_2744 (hisH)
    11819-97:
    MS7_2680 (hisH)
    71193:
    ST398NM01_2726
    ECT-R 2:
    ECTR2_2528 (hisH)
    ED133:
    SAOV_2726c
    ED98:
    SAAV_2748 (hisH)
    HO 5096 0412:
    SAEMRSA15_25810 (hisH)
    JH1:
    SaurJH1_2756 (hisH)
    JH9:
    SaurJH9_2699 (hisH)
    JKD6008:
    SAA6008_02734 (hisH)
    JKD6159:
    SAA6159_02572 (hisH)
    LGA251:
    SARLGA251_24480 (hisH)
    M013:
    M013TW_2658
    MRSA252:
    SAR2757 (hisH)
    MSHR1132:
    SAMSHR1132_25020
    MSSA476:
    SAS2560 (hisH)
    Mu3:
    SAHV_2659 (hisH)
    Mu50:
    SAV2675 (hisH)
    MW2:
    MW2594 (hisH)
    RF122:
    SAB2551c (hisH)
    ST398:
    SAPIG2726 (hisH)
    T0131:
    SAT0131_02954 (dfrB)
    TCH60:
    HMPREF0772_10511 (hisH)
    TW20:
    SATW20_28120 (hisH)
    USA300_TCH1516:
    USA300HOU_2676 (hisH)
    VC40:
    SAVC_12250 (hisH)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLN
    N315            MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLN
    NCTC8325        MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLN
    Newman          MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLN
    USA300_FPR3757  MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLN
                    ************************************************************

    COL             LNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLV
    N315            LNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLV
    NCTC8325        LNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLV
    Newman          LNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLV
    USA300_FPR3757  LNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLV
                    ************************************************************

    COL             SKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQI
    N315            SKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQI
    NCTC8325        SKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQI
    Newman          SKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQI
    USA300_FPR3757  SKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQI
                    ************************************************************

    COL             LRQAIQGGFIND
    N315            LRQAIQGGFIND
    NCTC8325        LRQAIQGGFIND
    Newman          LRQAIQGGFIND
    USA300_FPR3757  LRQAIQGGFIND
                    ************