From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2699 [new locus tag: SACOL_RS14120 ]
  • pan locus tag?: SAUPAN006430000
  • symbol: hisH
  • pan gene symbol?: hisH
  • synonym:
  • product: imidazole glycerol phosphate synthase subunit HisH

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2699 [new locus tag: SACOL_RS14120 ]
  • symbol: hisH
  • product: imidazole glycerol phosphate synthase subunit HisH
  • replicon: chromosome
  • strand: -
  • coordinates: 2772341..2772919
  • length: 579
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTGTCATCGTTGATTATGGATTAGGGAATATTAGTAATGTAAAACGCGCTATTGAA
    CATTTAGGGTATGAGGTGGTTGTCTCAAATACCTCAAAAATAATCGATCAAGCAGAAACA
    ATCATATTGCCCGGTGTCGGCCATTTTAAAGATGCGATGTCAGAGATAAAACGATTAAAT
    CTCAATGCAATATTGGCTAAGAATACTGATAAGAAGATGATTGGTATTTGTTTAGGCATG
    CAATTAATGTATGAGCATAGTGATGAAGGCGATGCATCTGGATTAGGGTTTATCCCAGGA
    AATATTTCGCGTATCCAAACAGAATACCCAGTGCCACACTTAGGCTGGAATAATTTAGTG
    AGTAAGCACCCTATGTTAAATCAAGATGTTTATTTCGTACATTCTTATCAAGCGCCGATG
    TCAGAAAATGTAATTGCATATGCGCAGTATGGGGCTGATATTCCGGCAATTGTTCAATTT
    AACAATTATATTGGTATTCAATTCCATCCTGAAAAAAGCGGTACATATGGGTTACAAATT
    TTGCGTCAGGCAATACAAGGGGGATTTATAAATGATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    579

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2699 [new locus tag: SACOL_RS14120 ]
  • symbol: HisH
  • description: imidazole glycerol phosphate synthase subunit HisH
  • length: 192
  • theoretical pI: 6.13987
  • theoretical MW: 21279.2
  • GRAVY: -0.0348958

Function[edit source | edit]

  • reaction:
    EC 2.4.2.-?  ExPASy
    5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide + L-glutamine = imidazole-glycerol phosphate + 5-aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H2O?
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 239.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 29.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 22.3)
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 18.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 15.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 15.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 14.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 13.5)
  • TheSEED:  
    Amino Acids and DerivativesHistidine MetabolismHistidine Biosynthesis in plants Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-) 
    Histidine MetabolismHistidine Biosynthesis Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-) 
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 64.1)
    SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 23.7)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 15.6)
    no clan definedUPF0180; Uncharacterised protein family (UPF0180) (PF03698; HMM-score: 15.4)
    Glutaminase_I (CL0014) Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 18
    • Cmax: 0.188
    • Cmax_pos: 18
    • Smax: 0.31
    • Smax_pos: 17
    • Smean: 0.109
    • D: 0.135
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: SACOL1968 (HisR*), CodY
    HisR*? (TF) important in Histidine biosynthesis  RegPrecise
    CodY? (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]