From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006432000
  • symbol?:
  • description?: histidinol-phosphate aminotransferase

      descriptions from strain specific annotations:

    • histidinol-phosphate aminotransferase
    • histidinol-phosphate aminotransferase hisC
    • aminotransferase class I and II family protein
    • class I and II aminotransferase
    • histidinol-phosphate aminotransferase, putative
    • histidinol-phosphate transaminase
    • pseudogene
    • putative aminotransferase
  • strand?: -
  • coordinates?: 6474000..6475013
  • synteny block?: BlockID0051390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2575 (hisC)
    USA300_FPR3757:
    04-02981:
    SA2981_2617
    08BA02176:
    C248_2746
    11819-97:
    MS7_2682
    71193:
    ST398NM01_2728
    ECT-R 2:
    ECTR2_2530
    ED133:
    SAOV_2728c
    ED98:
    SAAV_2750
    HO 5096 0412:
    SAEMRSA15_25830
    JH1:
    SaurJH1_2758
    JH9:
    SaurJH9_2701
    JKD6008:
    SAA6008_02736 (hisC)
    JKD6159:
    SAA6159_02574 (hisC)
    LGA251:
    SARLGA251_24500
    M013:
    M013TW_2660
    MRSA252:
    SAR2759
    MSHR1132:
    SAMSHR1132_25040
    MSSA476:
    SAS2562
    Mu3:
    SAHV_2661
    Mu50:
    SAV2677
    MW2:
    MW2596
    RF122:
    SAB2553c
    ST398:
    SAPIG2728
    T0131:
    SAT0131_02956
    TCH60:
    HMPREF0772_10509 (hisC)
    TW20:
    SATW20_28140
    USA300_TCH1516:
    USA300HOU_2678 (hisC2)
    VC40:
    SAVC_12260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYIDKNESPVTPLDEKTMTSIISATPYNLYPDAAYEQFKEAYAKFYGLSPEQIIAGNGS
    N315            MIYIDKNESPVTPLDEKTMTSIISATPYNLYPDAAYEQFKEAYAKFYGLSPEQIIAGNGS
    NCTC8325        MIYIDKNESPVTPLDEKTMTSIISATPYNLYPDAAYEQFKEAYAKFYGLSPEQIIAGNGS
    Newman          MIYIDKNESPVTPLDEKTMTSIISATPYNLYPDAAYEQFKEAYAKFYGLSPEQIIAGNGS
    USA300_FPR3757  MIYIDKNESPVTPLDEKTMTSIISATPYNLYPDAAYEQFKEAYAKFYGLSPEQIIAGNGS
                    ************************************************************

    COL             DELIQKLMLIMPEGPALTLNPDFFMYQAYAAQVNREIAFVDAGSDLTFDLETILTKIDEV
    N315            DELIQKLMLIMPEGPALTLNPDFFMYQAYAAQVNREIAFVDAGSDLTFDLETILTKIDEV
    NCTC8325        DELIQKLMLIMPEGPALTLNPDFFMYQAYAAQVNREIAFVDAGSDLTFDLETILTKIDEV
    Newman          DELIQKLMLIMPEGPALTLNPDFFMYQAYAAQVNREIAFVDAGSDLTFDLETILTKIDEV
    USA300_FPR3757  DELIQKLMLIMPEGPALTLNPDFFMYQAYAAQVNREIAFVDAGSDLTFDLETILTKIDEV
                    ************************************************************

    COL             QPSFFIMSNPHNPSGKQFDTAFLTAIADKMKALNGYFVIDEAYLDYGTAYDVELAPHILR
    N315            QPSFFIMSNPHNPSGKQFDTAFLTAIADKMKALNGYFVIDEAYLDYGTAYDVELAPHILR
    NCTC8325        QPSFFIMSNPHNPSGKQFDTAFLTAIADKMKALNGYFVIDEAYLDYGTAYDVELAPHILR
    Newman          QPSFFIMSNPHNPSGKQFDTAFLTAIADKMKALNGYFVIDEAYLDYGTAYDVELAPHILR
    USA300_FPR3757  QPSFFIMSNPHNPSGKQFDTAFLTAIADKMKALNGYFVIDEAYLDYGTAYDVELAPHILR
                    ************************************************************

    COL             MRTLSKAFGIAGLRLGVLISTAGTIKHIQKIEHPYPLNVFTLNIATYIFRHREETRQFLT
    N315            MRTLSKAFGIAGLRLGVLISTAGTIKHIQKIEHPYPLNVFTLNIATYIFRHREETRVFLT
    NCTC8325        MRTLSKAFGIAGLRLGVLISTAGTIKHIQKIEHPYPLNVFTLNIATYIFRHREETRQFLT
    Newman          MRTLSKAFGIAGLRLGVLISTAGTIKHIQKIEHPYPLNVFTLNIATYIFRHREETRQFLT
    USA300_FPR3757  MRTLSKAFGIAGLRLGVLISTAGTIKHIQKIEHPYPLNVFTLNIATYIFRHREETRQFLT
                    ******************************************************** ***

    COL             MQRQLAEQLKQIFDTHVADKMSVFPSNANFVLTKGSAAQQLGQYVYEQGFKPRFYDEPVM
    N315            MQRQLAEQLKQIFDTHVADKMSVFPSNANFVLTKGSAAHQLGQYVYEQGFKPRFYDEPVM
    NCTC8325        MQRQLAEQLKQIFDTHVADKMSVFPSNANFVLTKGSAAQQLGQYVYEQGFKPRFYDEPVM
    Newman          MQRQLAEQLKQIFDTHVADKMSVFPSNANFVLTKGSAAQQLGQYVYEQGFKPRFYDEPVM
    USA300_FPR3757  MQRQLAEQLKQIFDTHVADKMSVFPSNANFVLTKGSAAQQLGQYVYEQGFKPRFYDEPVM
                    **************************************:*********************

    COL             KGYVRYSIATASQLKQLEEIVKEWSAKYDLSKTTKHS
    N315            KGYVRYSIATASQLKQLEEIVKEWSAKYDLSKTTKHS
    NCTC8325        KGYVRYSIATASQLKQLEEIVKEWSAKYDLSKTTKHS
    Newman          KGYVRYSIATASQLKQLEEIVKEWSAKYDLSKTTKHS
    USA300_FPR3757  KGYVRYSIATASQLKQLEEIVKEWSAKYDLSKTTKHS
                    *************************************