From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006435000
  • symbol?: hisZ
  • description?: ATP phosphoribosyltransferase

      descriptions from strain specific annotations:

    • ATP phosphoribosyltransferase
    • ATP phosphoribosyltransferase regulatory subunit
  • strand?: -
  • coordinates?: 6476900..6477576
  • synteny block?: BlockID0051420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2704 (hisZ)
    N315:
    SA2472 (hisZ)
    NCTC8325:
    Newman:
    NWMN_2578 (hisZ)
    USA300_FPR3757:
    04-02981:
    SA2981_2620
    08BA02176:
    C248_2749
    11819-97:
    MS7_2685 (hisZ)
    71193:
    ST398NM01_2731
    ECT-R 2:
    ECTR2_2533
    ED133:
    SAOV_2731c
    ED98:
    SAAV_2754 (hisZ)
    HO 5096 0412:
    SAEMRSA15_25860
    JH1:
    SaurJH1_2761 (hisZ)
    JH9:
    SaurJH9_2704 (hisZ)
    JKD6008:
    SAA6008_02739 (hisZ)
    JKD6159:
    SAA6159_02577 (hisZ)
    LGA251:
    SARLGA251_24530 (hisZ)
    M013:
    M013TW_2663
    MRSA252:
    SAR2762 (hisZ)
    MSHR1132:
    SAMSHR1132_25070
    MSSA476:
    SAS2565 (hisZ)
    Mu3:
    SAHV_2664 (hisZ)
    Mu50:
    SAV2680 (hisZ)
    MW2:
    MW2599 (hisZ)
    RF122:
    SAB2556c (hisZ)
    ST398:
    SAPIG2731
    T0131:
    SAT0131_02959
    TCH60:
    HMPREF0772_10506 (hisZ)
    TW20:
    SATW20_28170 (hisZ)
    USA300_TCH1516:
    USA300HOU_2681 (hisZ)
    VC40:
    SAVC_12275 (hisZ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEH
    N315            MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEH
    NCTC8325        MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEH
    Newman          MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEH
    USA300_FPR3757  MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEH
                    ************************************************************

    COL             QIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLK
    N315            QIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLK
    NCTC8325        QIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLK
    Newman          QIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLK
    USA300_FPR3757  QIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLK
                    ************************************************************

    COL             LFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPI
    N315            LFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPI
    NCTC8325        LFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPI
    Newman          LFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPI
    USA300_FPR3757  LFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPI
                    ************************************************************

    COL             VQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHKQGYKDIHLDITAQPPRSYYTGL
    N315            VQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHTQGYKDIHLDITAQPPRSYYTGL
    NCTC8325        VQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHKQGYKDIHLDITAQPPRSYYTGL
    Newman          VQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHKQGYKDIHLDITAQPPRSYYTGL
    USA300_FPR3757  VQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHKQGYKDIHLDITAQPPRSYYTGL
                    *************************************.**********************

    COL             FIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
    N315            FIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
    NCTC8325        FIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
    Newman          FIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
    USA300_FPR3757  FIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
                    ********************************