From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006437000
  • symbol?:
  • description?: polysaccharide deacetylase family protein

      descriptions from strain specific annotations:

    • polysaccharide deacetylase family protein
    • putative lipoprotein
    • polysaccharide deacetylase domain protein
  • strand?: -
  • coordinates?: 6478036..6479161
  • synteny block?: BlockID0051440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2621
    08BA02176:
    C248_2750
    11819-97:
    MS7_2686
    71193:
    ST398NM01_2732
    ECT-R 2:
    ECTR2_2534
    ED133:
    SAOV_2732c
    ED98:
    SAAV_2755
    HO 5096 0412:
    SAEMRSA15_25870
    JH1:
    SaurJH1_2762
    JH9:
    SaurJH9_2705
    JKD6008:
    SAA6008_02740
    JKD6159:
    SAA6159_02578
    LGA251:
    SARLGA251_24540
    M013:
    M013TW_2664
    MRSA252:
    SAR2763
    MSHR1132:
    SAMSHR1132_25090
    MSSA476:
    SAS2566
    Mu3:
    SAHV_2665
    Mu50:
    SAV2681
    MW2:
    MW2600
    RF122:
    SAB2557c
    ST398:
    SAPIG2732
    T0131:
    SAT0131_02960
    TCH60:
    HMPREF0772_10505
    TW20:
    SATW20_28180
    USA300_TCH1516:
    USA300HOU_2683
    VC40:
    SAVC_12280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKKYLLLFFLLLSVALLYSCSKQNEKAQNKSVNPNEYAKHKSKMDEHWETYHGQVYHVF
    N315            MHKKYLLLFFLLLSVALLYSCSKQNEKAQNKSVNPNEYAKHKSKMDEHWETYHGQVYHVF
    NCTC8325        MHKKYLLLFFLLLSVALLYSCSKQNEKAQNKSVNPNEYAKHKSKMDEHWETYHGQVYHVF
    Newman          MHKKYLLLFFLLLSVALLYSCSKQNEKAQNKSVNPNEYAKHKSKMDEHWETYHGQVYHVF
    USA300_FPR3757  MHKKYLLLFFLLLSVALLYSCSKQNEKAQNKSVNPNEYAKHKSKMDEHWETYHGQVYHVF
                    ************************************************************

    COL             YHPLITDPKVAFTGDTHQAKGNNDWMITVSEFKKSLNELYKNNYIIVNPHDVYDLSSHHV
    N315            YHPLITDPKVAFTGDTHQAKGNNDWMITVSEFKKSLNELYKNNYIIVNPHDVYDLSSHHV
    NCTC8325        YHPLITDPKVAFTGDTHQAKGNNDWMITVSEFKKSLNELYKNNYIIVNPHDVYDLSSHHV
    Newman          YHPLITDPKVAFTGDTHQAKGNNDWMITVSEFKKSLNELYKNNYIIVNPHDVYDLSSHHV
    USA300_FPR3757  YHPLITDPKVAFTGDTHQAKGNNDWMITVSEFKKSLNELYKNNYIIVNPHDVYDLSSHHV
                    ************************************************************

    COL             KAKKIKLPKGKKPLIISIDDMNYYSYMRHHGYADRLVLDKNKHVVSETTDKKGHATYSDD
    N315            KAKKIKLPKGKKPLIISIDDMNYYSYMRHHGYADRLVLDKNKHVVSETTDKKGHATYSDD
    NCTC8325        KAKKIKLPKGKKPLIISIDDMNYYSYMRHHGYADRLVLDKNKHVVSETTDKKGHATYSDD
    Newman          KAKKIKLPKGKKPLIISIDDMNYYSYMRHHGYADRLVLDKNKHVVSETTDKKGHATYSDD
    USA300_FPR3757  KAKKIKLPKGKKPLIISIDDMNYYSYMRHHGYADRLVLDKNKHVVSETTDKKGHATYSDD
                    ************************************************************

    COL             NDIVPILNKFVKEHPDFSLNGEKGVVALTGYEGVLGYRTNELTSKDYTKNKKAAEEVVRA
    N315            NDIVPILNKFVKEHPDFSLNGEKGVVALTGYEGVLGYRTNELTSKDYTKNKKAAEEVVRA
    NCTC8325        NDIVPILNKFVKEHPDFSLNGEKGVVALTGYEGVLGYRTNELTSKDYTKNKKAAEEVVRA
    Newman          NDIVPILNKFVKEHPDFSLNGEKGVVALTGYEGVLGYRTNELTSKDYTKNKKAAEEVVRA
    USA300_FPR3757  NDIVPILNKFVKEHPDFSLNGEKGVVALTGYEGVLGYRTNELTSKDYTKNKKAAEEVVRA
                    ************************************************************

    COL             MKRDGWSFASHSYGHINFEKTSLEGIKRDTKRWKDEVEPIVGKTDMFVFPHGAQDRHTQA
    N315            MKRDGWSFASHSYGHINFEKTSLEGIKRDTKRWKDEVEPIVGKTDMFVFPHGAQDRHTQA
    NCTC8325        MKRDGWSFASHSYGHINFEKTSLEGIKRDTKRWKDEVEPIVGKTDMFVFPHGAQDRHTQA
    Newman          MKRDGWSFASHSYGHINFEKTSLEGIKRDTKRWKDEVEPIVGKTDMFVFPHGAQDRHTQA
    USA300_FPR3757  MKRDGWSFASHSYGHINFEKTSLEGIKRDTKRWKDEVEPIVGKTDMFVFPHGAQDRHTQA
                    ************************************************************

    COL             YDYLVDEAEFKFIAGVGPNNFTDISATNVYQDRVAIDGLNLFEFKYKLKPFFNPENVYSK
    N315            YDYLVDEAEFKFIAGVGPNNFTDISATNVYQDRVAIDGLNLFEFKYKLKPFFNPENVYSK
    NCTC8325        YDYLVDEAEFKFIAGVGPNNFTDISATNVYQDRVAIDGLNLFEFKYKLKPFFNPENVYSK
    Newman          YDYLVDEAEFKFIAGVGPNNFTDISATNVYQDRVAIDGLNLFEFKYKLKPFFNPENVYSK
    USA300_FPR3757  YDYLVDEAEFKFIAGVGPNNFTDISATNVYQDRVAIDGLNLFEFKYKLKPFFNPENVYSK
                    ************************************************************

    COL             QDRRYFKGNRDYEE
    N315            QDRQFFKGNRDYEE
    NCTC8325        QDRRYFKGNRDYEE
    Newman          QDRRYFKGNRDYEE
    USA300_FPR3757  QDRRYFKGNRDYEE
                    ***::*********