From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006439000
  • symbol?:
  • description?: cobalt ABC transporter

      descriptions from strain specific annotations:

    • cobalt ABC transporter
    • cobalt transport protein
    • cobalt transport family protein
    • Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
    • ABC transporter permease
    • cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
    • transmembrane component MtsC
  • strand?: -
  • coordinates?: 6479823..6480656
  • synteny block?: BlockID0051460
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2623 (mtsC)
    08BA02176:
    11819-97:
    MS7_2688
    71193:
    ECT-R 2:
    ECTR2_2536
    ED133:
    ED98:
    SAAV_2757
    HO 5096 0412:
    JH1:
    SaurJH1_2764
    JH9:
    SaurJH9_2707
    JKD6008:
    SAA6008_02742
    JKD6159:
    SAA6159_02580
    LGA251:
    M013:
    M013TW_2666
    MRSA252:
    SAR2765
    MSHR1132:
    SAMSHR1132_25110
    MSSA476:
    SAS2568
    Mu3:
    SAHV_2667
    Mu50:
    SAV2683
    MW2:
    MW2602
    RF122:
    SAB2559c
    ST398:
    T0131:
    SAT0131_02962
    TCH60:
    HMPREF0772_10503
    TW20:
    SATW20_28200
    USA300_TCH1516:
    USA300HOU_2685
    VC40:
    SAVC_12290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
    N315            MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLFKYAHI
    NCTC8325        MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
    Newman          MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
    USA300_FPR3757  MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
                    ******************************************************.*****

    COL             EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
    N315            EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
    NCTC8325        EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
    Newman          EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
    USA300_FPR3757  EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
                    ************************************************************

    COL             LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
    N315            LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
    NCTC8325        LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
    Newman          LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
    USA300_FPR3757  LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
                    ************************************************************

    COL             AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
    N315            AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
    NCTC8325        AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
    Newman          AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
    USA300_FPR3757  AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
                    ************************************************************

    COL             KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
    N315            KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
    NCTC8325        KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
    Newman          KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
    USA300_FPR3757  KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
                    *************************************