From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006449000
  • symbol?:
  • description?: PadR-like family transcriptional regulator

      descriptions from strain specific annotations:

    • PadR-like family transcriptional regulator
    • PadR family transcriptional regulator
    • Transcriptional regulator, PadR family
    • transcriptional regulator PadR-like family protein
    • PadR family regulatory protein
  • strand?: -
  • coordinates?: 6493154..6493492
  • synteny block?: BlockID0051560
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2632
    08BA02176:
    C248_2756 (padR)
    11819-97:
    MS7_2698
    71193:
    ST398NM01_2738
    ECT-R 2:
    ECTR2_2545
    ED133:
    ED98:
    SAAV_2765
    HO 5096 0412:
    JH1:
    SaurJH1_2773
    JH9:
    SaurJH9_2716
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_2675
    MRSA252:
    MSHR1132:
    SAMSHR1132_25210
    MSSA476:
    Mu3:
    SAHV_2676
    Mu50:
    SAV2692
    MW2:
    RF122:
    SAB2568c
    ST398:
    SAPIG2738
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2694
    VC40:
    SAVC_12335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
    N315            MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
    NCTC8325        MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
    Newman          MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
    USA300_FPR3757  MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
                    ************************************************************

    COL             DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQVLNKGMINLFGGENDVK
    N315            DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
    NCTC8325        DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQVLNKGMINLFGGENDVK
    Newman          DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQVLNKGMINLFGGENDVK
    USA300_FPR3757  DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQVLNKGMINLFGGENDVK
                    ***********************************.***************: