From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006487000
  • symbol?: gidB
  • description?: 16S rRNA methyltransferase GidB

      descriptions from strain specific annotations:

    • 16S rRNA methyltransferase GidB
    • ribosomal RNA small subunit methyltransferase G
    • glucose-inhibited division protein B
    • Methyltransferase
    • putative glucose inhibited division protein B
    • rRNA small subunit methyltransferase, glucoseinhibited division protein GidB
    • rRNA small subunit methyltransferase G
  • strand?: -
  • coordinates?: 6521329..6522048
  • synteny block?: BlockID0051940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2736 (gidB)
    N315:
    SA2499 (gidB)
    NCTC8325:
    Newman:
    NWMN_2610 (gidB)
    USA300_FPR3757:
    04-02981:
    SA2981_2649 (gidB)
    08BA02176:
    C248_2775 (gidB)
    11819-97:
    MS7_2714 (gidB)
    71193:
    ST398NM01_2755
    ECT-R 2:
    ECTR2_2561 (gidB)
    ED133:
    SAOV_2751c
    ED98:
    SAAV_2781 (gidB)
    HO 5096 0412:
    SAEMRSA15_26080 (gidB)
    JH1:
    SaurJH1_2789 (gidB)
    JH9:
    SaurJH9_2732 (gidB)
    JKD6008:
    SAA6008_02771 (gidB)
    JKD6159:
    SAA6159_02603 (gidB)
    LGA251:
    SARLGA251_24740 (gidB)
    M013:
    M013TW_2696
    MRSA252:
    SAR2796 (gidB)
    MSHR1132:
    SAMSHR1132_25370
    MSSA476:
    SAS2592 (gidB)
    Mu3:
    SAHV_2694 (gidB)
    Mu50:
    SAV2710 (gidB)
    MW2:
    MW2628 (gidB)
    RF122:
    SAB2586c (gidB)
    ST398:
    SAPIG2755 (gidB)
    T0131:
    SAT0131_02992 (recU)
    TCH60:
    HMPREF0772_10472 (gidB)
    TW20:
    SATW20_28480 (gidB)
    USA300_TCH1516:
    USA300HOU_2713 (gidB)
    VC40:
    SAVC_12440 (gidB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVEWLAEQLKEHNIQLTETQKQQFQTYYRLLVEWNEKMNLTSITDEHDVYLKHFYDSIA
    N315            MTVEWLAEQLKEHNIELTETQKQQFQTYYRLLVEWNEKMNLTSITDEHDVYLKHFYDSIA
    NCTC8325        MTVEWLAEQLKEHNIQLTETQKQQFQTYYRLLVEWNEKMNLTSITDEHDVYLKHFYDSIA
    Newman          MTVEWLAEQLKEHNIQLTETQKQQFQTYYRLLVEWNEKMNLTSITDEHDVYLKHFYDSIA
    USA300_FPR3757  MTVEWLAEQLKEHNIQLTETQKQQFQTYYRLLVEWNEKMNLTSITDEHDVYLKHFYDSIA
                    ***************:********************************************

    COL             PSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQD
    N315            PSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQD
    NCTC8325        PSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQD
    Newman          PSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQD
    USA300_FPR3757  PSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQD
                    ************************************************************

    COL             VSFIHDRAETFGKGVYRESYDVVTARAVARLSVLSELCLPLVKKGGQFVALKSSKGEEEL
    N315            VSFIHDRAETFGKGVYRESYDVVTARAVARLSVLSELCLPLIKKGGQFVALKSSKGEEEL
    NCTC8325        VSFIHDRAETFGKGVYRESYDVVTARAVARLSVLSELCLPLVKKGGQFVALKSSKGEEEL
    Newman          VSFIHDRAETFGKGVYRESYDVVTARAVARLSVLSELCLPLVKKGGQFVALKSSKGEEEL
    USA300_FPR3757  VSFIHDRAETFGKGVYRESYDVVTARAVARLSVLSELCLPLVKKGGQFVALKSSKGEEEL
                    *****************************************:******************

    COL             EEAKFAISVLGGNVTETHTFELPEDAGERQMFIIDKKRQTPKKYPRKPGTPNKTPLLEK
    N315            EEAKFAISVLGGNVTETHTFKLPEDAGERQMFIIDKKRQTPKKYPRKPGTPNKTPLLEK
    NCTC8325        EEAKFAISVLGGNVTETHTFELPEDAGERQMFIIDKKRQTPKKYPRKPGTPNKTPLLEK
    Newman          EEAKFAISVLGGNVTETHTFELPEDAGERQMFIIDKKRQTPKKYPRKPGTPNKTPLLEK
    USA300_FPR3757  EEAKFAISVLGGNVTETHTFELPEDAGERQMFIIDKKRQTPKKYPRKPGTPNKTPLLEK
                    ********************:**************************************