From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006488000
  • symbol?: gidA
  • description?: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG

      descriptions from strain specific annotations:

    • tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG
    • tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
    • tRNA uridine 5-carboxymethylaminomethyl modification protein GidA
    • glucose inhibited division protein A
    • tRNA uridine 5-carboxymethylaminomethyl modification protein MnmG
  • strand?: -
  • coordinates?: 6522048..6523832
  • synteny block?: BlockID0051950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2737 (gidA)
    N315:
    SA2500 (gidA)
    NCTC8325:
    Newman:
    NWMN_2611 (gidA)
    USA300_FPR3757:
    04-02981:
    SA2981_2650 (gidA)
    08BA02176:
    C248_2776 (gidA)
    11819-97:
    MS7_2715 (gidA)
    71193:
    ST398NM01_2756
    ECT-R 2:
    ECTR2_2562 (gidA)
    ED133:
    SAOV_2752c
    ED98:
    SAAV_2782 (gidA)
    HO 5096 0412:
    SAEMRSA15_26090 (gidA)
    JH1:
    SaurJH1_2790 (gidA)
    JH9:
    SaurJH9_2733 (gidA)
    JKD6008:
    SAA6008_02772 (gidA)
    JKD6159:
    SAA6159_02604 (gidA)
    LGA251:
    SARLGA251_24750 (gidA)
    M013:
    M013TW_2697
    MRSA252:
    SAR2797 (gidA)
    MSHR1132:
    SAMSHR1132_25380
    MSSA476:
    SAS2593 (gidA)
    Mu3:
    SAHV_2695 (gidA)
    Mu50:
    SAV2711 (gidA)
    MW2:
    MW2629 (gidA)
    RF122:
    SAB2587c (gidA)
    ST398:
    SAPIG2756 (gidA)
    T0131:
    SAT0131_02993
    TCH60:
    HMPREF0772_10471 (gidA)
    TW20:
    SATW20_28490 (gidA)
    USA300_TCH1516:
    USA300HOU_2714 (gidA)
    VC40:
    SAVC_12445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVRE
    N315            MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVRE
    NCTC8325        MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVRE
    Newman          MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVRE
    USA300_FPR3757  MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVRE
                    ************************************************************

    COL             IDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQ
    N315            IDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQ
    NCTC8325        IDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQ
    Newman          IDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQ
    USA300_FPR3757  IDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQ
                    ************************************************************

    COL             GMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT
    N315            GMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT
    NCTC8325        GMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT
    Newman          GMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT
    USA300_FPR3757  GMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT
                    ************************************************************

    COL             LSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYILDQLPCW
    N315            LSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYILDQLPCW
    NCTC8325        LSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYILDQLPCW
    Newman          LSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYILDQLPCW
    USA300_FPR3757  LSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYILDQLPCW
                    ************************************************************

    COL             LTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRN
    N315            LTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRN
    NCTC8325        LTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRN
    Newman          LTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRN
    USA300_FPR3757  LTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRN
                    ************************************************************

    COL             TNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIK
    N315            TNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIK
    NCTC8325        TNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIK
    Newman          TNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIK
    USA300_FPR3757  TNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIK
                    ************************************************************

    COL             NLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTN
    N315            NLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTN
    NCTC8325        NLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTN
    Newman          NLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTN
    USA300_FPR3757  NLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTN
                    ************************************************************

    COL             EPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDI
    N315            EPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDI
    NCTC8325        EPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDI
    Newman          EPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDI
    USA300_FPR3757  EPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDI
                    ************************************************************

    COL             RIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEI
    N315            RIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILEILEEEHQLNADVEEQVEI
    NCTC8325        RIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEI
    Newman          RIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEI
    USA300_FPR3757  RIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEI
                    ******************************************:*****************

    COL             QTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRI
    N315            QTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRI
    NCTC8325        QTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRI
    Newman          QTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRI
    USA300_FPR3757  QTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRI
                    ************************************************************

    COL             SGVNPADISILLIYLEQGKLQRVSD
    N315            SGVNPADISILLIYLEQGKLQRVSD
    NCTC8325        SGVNPADISILLIYLEQGKLQRVSD
    Newman          SGVNPADISILLIYLEQGKLQRVSD
    USA300_FPR3757  SGVNPADISILLIYLEQGKLQRVSD
                    *************************