Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0169 [new locus tag: SAUSA300_RS00890 ]
  • pan locus tag?: SAUPAN001002000
  • symbol: SAUSA300_0169
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0169 [new locus tag: SAUSA300_RS00890 ]
  • symbol: SAUSA300_0169
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 191128..191511
  • length: 384
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCGACTTATTTTAATCGTCATTGGCTTAATATTTACAGCGCTTGGTATTGCAGGTGCC
    GTATTACCTTTACTGCCAACGACCCCTTTTTTACTCGTAGCAGTTTTTTGTTTTGCTCGA
    AGTTCAGATCGCTTTTACAATTGGCTTATTAATCAAAAAATTTATAAAGAATATGTAGAA
    AACTTTTATTTACATCGAGGCTACACGCTACAACAGAAAATTAAAATTTTAATTAGCTTA
    TACATTGTAATAGGTTTTTCAATTTATATGGTGGATGTTCTTGCAGTCCGTGTAGGATTA
    ATCATAATGGTTATCATACAAACCGCTGTACTCTTTACATTTGTAAAAACATTACCCAAA
    TCAAATCATAAAATAGAGGAGTGA
    60
    120
    180
    240
    300
    360
    384

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0169 [new locus tag: SAUSA300_RS00890 ]
  • symbol: SAUSA300_0169
  • description: hypothetical protein
  • length: 127
  • theoretical pI: 9.99954
  • theoretical MW: 14569.6
  • GRAVY: 0.922047

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Heme, hemin uptake and utilization systems in GramPositives Inner membrane protein YbaN 
  • PFAM:
    no clan definedDUF454; Protein of unknown function (DUF454) (PF04304; HMM-score: 127.5)
    Glyoxalase (CL0104) Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 16.7)
    no clan definedDUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 13.1)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 5.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.341
    • Ymax_pos: 21
    • Cmax: 0.384
    • Cmax_pos: 21
    • Smax: 0.465
    • Smax_pos: 4
    • Smean: 0.343
    • D: 0.342
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPKSNHKIEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]