From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0245 [new locus tag: SAUSA300_RS01310 ]
  • pan locus tag?: SAUPAN001123000
  • symbol: SAUSA300_0245
  • pan gene symbol?: tarI'
  • synonym:
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0245 [new locus tag: SAUSA300_RS01310 ]
  • symbol: SAUSA300_0245
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 294558..295232
  • length: 675
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGGGAACGTGCCATTACCAAAACAATTTTTAGATATTGATAATAAACCGATTTTAATC
    CATACAATTGAGAAGTTCATTTTAGTGAGTGAATTTAATGAGATTATTATCGCAACGCCA
    GCACAGTGGATTTCCCATACACAGGATATTTTAAAAAAATATAACATTACAGATCAACGT
    GTCAAAGTAGTTGCAGGTGGTACGGATCGAAATGAAACAATTATGAACATTATCGACCAT
    ATTCGCAATGTAAATGGAATTAATAATGATGATGTGATTGTAACTCATGATGCCGTAAGA
    CCATTTTTAACTCAACGTATTATTAAAGAGAACATTGAAGTAGCAGCAAAATATGGTGCA
    GTAGATACAGTCATTGAAGCAATTGATACGATTGTAATGTCTAAAGATAAACAGAACATA
    CACAGTATCCCTGTAAGGAATGAAATGTATCAAGGCCAAACACCACAATCATTTAATATT
    AAATTATTACAAGATAGTTATCGCGCCTTAAGTAGTGAACAAAAAGAAATCTTATCAGAT
    GCATGTAAAATCATTGTCGAATCTGGACATGCAGTTAAATTGGTACGTGGAGAACTATAC
    AACATTAAAGTGACAACACCGTATGATTTAAAAGTAGCAAATGCCATTATTCAAGGTGAT
    ATTGCCGATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0245 [new locus tag: SAUSA300_RS01310 ]
  • symbol: SAUSA300_0245
  • description: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • length: 224
  • theoretical pI: 5.61876
  • theoretical MW: 25213.7
  • GRAVY: -0.159821

Function[edit source | edit]

  • reaction:
    EC 2.7.7.60?  ExPASy
    2-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseCTP + 2-C-methyl-D-erythritol 4-phosphate = diphosphate + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TIGR00453; EC 2.7.7.60; HMM-score: 146.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate cytidylyltransferase (TIGR00466; EC 2.7.7.38; HMM-score: 19.3)
    pseudaminic acid cytidylyltransferase (TIGR03584; EC 2.7.7.81; HMM-score: 13.4)
  • TheSEED:  
    Cell Wall and CapsuleGram-Positive cell wall componentsTeichoic and lipoteichoic acids biosynthesis 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) 
    Fatty Acids, Lipids, and IsoprenoidsIsoprenoidsIsoprenoid Biosynthesis 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) 
  • PFAM:
    GT-A (CL0110) IspD; 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (PF01128; HMM-score: 137.4)
    CTP_transf_3; Cytidylyltransferase (PF02348; HMM-score: 19.9)
    NTP_transf_3; MobA-like NTP transferase domain (PF12804; HMM-score: 15.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 44
    • Cmax: 0.189
    • Cmax_pos: 44
    • Smax: 0.171
    • Smax_pos: 34
    • Smean: 0.097
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGNVPLPKQFLDIDNKPILIHTIEKFILVSEFNEIIIATPAQWISHTQDILKKYNITDQRVKVVAGGTDRNETIMNIIDHIRNVNGINNDDVIVTHDAVRPFLTQRIIKENIEVAAKYGAVDTVIEAIDTIVMSKDKQNIHSIPVRNEMYQGQTPQSFNIKLLQDSYRALSSEQKEILSDACKIIVESGHAVKLVRGELYNIKVTTPYDLKVANAIIQGDIADD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]