From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0374 [new locus tag: SAUSA300_RS01990 ]
  • pan locus tag?: SAUPAN001973000
  • symbol: SAUSA300_0374
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0374 [new locus tag: SAUSA300_RS01990 ]
  • symbol: SAUSA300_0374
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 424839..425090
  • length: 252
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTATTGGAATGTTAATTGTCGGTGGCTTAATTGGATGGGCTGCTGGTGCT
    ATTATGGGTAAAGATATCCCAGGTGGTATTTTAGGCAATATTATCGCAGGTATTATTGGA
    TCATGGGTAGGTGGCAAACTATTCGGACAATGGGGTCCTGAATTAGGAAGTATTTACATC
    TTGCCAGCATTAATTGGTTCAATTATCTTAATTGCAATCGTAACGTTAATTTTAAGAGCT
    ATGCGTAAATAA
    60
    120
    180
    240
    252

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0374 [new locus tag: SAUSA300_RS01990 ]
  • symbol: SAUSA300_0374
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 10.6301
  • theoretical MW: 8533.45
  • GRAVY: 1.28193

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingproteobacterial sortase system peptidoglycan-associated protein (TIGR03789; HMM-score: 8.5)
  • TheSEED:  
    FIG01108348: hypothetical protein 
  • PFAM:
    no clan definedTransgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 49.2)
    DUF21; Domain of unknown function DUF21 (PF01595; HMM-score: 9)
    Glycine-zipper (CL0500) Gly-zipper_Omp; Glycine zipper (PF13488; HMM-score: 6.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Secreted via minor pathways (bacteriocin) (no CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Non-classical
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 21
    • Cmax: 0.172
    • Cmax_pos: 21
    • Smax: 0.204
    • Smax_pos: 17
    • Smean: 0.135
    • D: 0.146
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]