Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0804 [new locus tag: SAUSA300_RS04340 ]
  • pan locus tag?: SAUPAN002848000
  • symbol: SAUSA300_0804
  • pan gene symbol?:
  • synonym:
  • product: putative transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0804 [new locus tag: SAUSA300_RS04340 ]
  • symbol: SAUSA300_0804
  • product: putative transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 885817..886059
  • length: 243
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    TTGAGAGCGGAAAGAATAGCTTGTGGTATTACGCAAGATGAAATGGCTCACAAAATGGGG
    TGGAAAACAAGAACGCCTTATGCAAAGAGAGAAAATGGAATAGTAGATATTGGAGCGAAT
    GAATTTATTAAAATGGCAAAAATATTAGGTTATGAAACAAATAACCTAGACATTTTTTTT
    ACCAATAACGTTCCCGGAAAAGAACGAAAAAACATCTTAAAAGGAGGTGAATTAAATGTC
    TAG
    60
    120
    180
    240
    243

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0804 [new locus tag: SAUSA300_RS04340 ]
  • symbol: SAUSA300_0804
  • description: putative transcriptional regulator
  • length: 80
  • theoretical pI: 9.68687
  • theoretical MW: 9071.44
  • GRAVY: -0.54625

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 14.7)
  • TheSEED:  
    Phages, Prophages, Transposable elements, PlasmidsPathogenicity islandsStaphylococcal pathogenicity islands SaPI Cro-like repressor, superantigen-encoding pathogenicity islands SaPI 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 32.3)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 23.1)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 17.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 24
    • Cmax: 0.114
    • Cmax_pos: 19
    • Smax: 0.152
    • Smax_pos: 18
    • Smean: 0.097
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRAERIACGITQDEMAHKMGWKTRTPYAKRENGIVDIGANEFIKMAKILGYETNNLDIFFTNNVPGKERKNILKGGELNV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]