Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2354 [new locus tag: SAUSA300_RS13000 ]
  • pan locus tag?: SAUPAN005943000
  • symbol: SAUSA300_2354
  • pan gene symbol?: dsbA
  • synonym:
  • product: putative lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2354 [new locus tag: SAUSA300_RS13000 ]
  • symbol: SAUSA300_2354
  • product: putative lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 2530872..2531471
  • length: 600
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGACTAAAAAATTACTAACATTATTTATAGTGAGCATGTTAATTTTAACAGCTTGCGGT
    AAAAAAGAATCAGCAACGACATCTTCGAAAAACGGCAAACCATTAGTTGTCGTATATGGC
    GACTATAAATGTCCTTATTGTAAAGAATTAGATGAAAAAGTCATGCCAAAGTTGCGTAAA
    AATTATATAGATAATCACAAAGTGGAATACCAATTTGTCAATTTAGCTTTCTTAGGTAAA
    GACTCAATTGTTGGTTCGCGTGCGAGTCATGCAGTATTGATGTATGCACCTAAATCATTT
    TTAGATTTTCAAAAGCAATTATTTGCTGCCCAGCAAGATGAAAATAAAGAATGGTTAACA
    AAAGAACTATTAGATAAACATATTAAACAACTGCATTTAGATAAAGAGACGGAAAATAAA
    ATTATAAAAGATTACAAGACAAAAGATAGCAAGTCTTGGAAAGCTGCAGAGAAAGATAAA
    AAAATAGCGAAAGATAATCATATAAAAACGACACCAACTGCATTTATTAATGGCGAGAAA
    GTTGAAGATCCATATGATTATGAAAGTTATGAGAAGTTATTAAAAGATAAAATCAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_2354 [new locus tag: SAUSA300_RS13000 ]
  • symbol: SAUSA300_2354
  • description: putative lipoprotein
  • length: 199
  • theoretical pI: 9.67715
  • theoretical MW: 23061.6
  • GRAVY: -0.680402

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    glutaredoxin, GrxA family (TIGR02183; HMM-score: 16.9)
    glutaredoxin (TIGR02180; HMM-score: 15.9)
    MetabolismEnergy metabolismElectron transportglutaredoxin 3 (TIGR02181; HMM-score: 13.6)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 11.4)
    extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 11)
  • TheSEED:  
    Protein-disulfide isomerase, related to DsbA 
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 96.1)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 33.3)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 32.7)
    Thioredoxin_5; Thioredoxin (PF13743; HMM-score: 18.6)
    no clan definedImm42; Immunity protein 42 (PF15593; HMM-score: 17.6)
    Thioredoxin (CL0172) Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 16.8)
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 16.8)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 15.1)
    C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.1)
    Zn_Beta_Ribbon (CL0167) Toprim_Crpt; C-terminal repeat of topoisomerase (PF13342; HMM-score: 13)
    Thioredoxin (CL0172) Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 9.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: ILTACGK
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.481
    • Ymax_pos: 26
    • Cmax: 0.297
    • Cmax_pos: 26
    • Smax: 0.942
    • Smax_pos: 16
    • Smean: 0.808
    • D: 0.608
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKDKIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]