From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • pan locus tag?: SAUPAN003441000
  • symbol: SAUSA300_RS05795
  • pan gene symbol?: psmβ2
  • synonym:
  • product: hemolytic protein

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • symbol: SAUSA300_RS05795
  • product: hemolytic protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1168589..1168723
  • length: 135
  • essential: unknown

⊟Accession numbers[edit source | edit]

  • Location: NC_007793 (1168589..1168723) NCBI
  • MicrobesOnline:

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGACTGGACTAGCAGAAGCAATCGCAAATACTGTGCAAGCTGCACAACAACATGATAGT
    GTGAAATTAGGCACAAGTATCGTAGACATCGTTGCTAACGGTGTGGGTTTACTAGGTAAA
    TTATTTGGATTCTAA
    60
    120
    135

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • symbol: SAUSA300_RS05795
  • description: hemolytic protein
  • length: 44
  • theoretical pI: 5.51933
  • theoretical MW: 4456.1
  • GRAVY: 0.606818

⊟Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedStaph_haemo; Staphylococcus haemolytic protein (PF05480; HMM-score: 85)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 15
    • Cmax: 0.285
    • Cmax_pos: 15
    • Smax: 0.261
    • Smax_pos: 14
    • Smean: 0.088
    • D: 0.132
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

  • GI: 446069248 NCBI
  • RefSeq: WP_000147103 NCBI
  • UniProt:

⊟Protein sequence[edit source | edit]

  • MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

  • SAUSA300_RS05795 no polycistronic organisation predicted

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS05795&oldid=75752"