Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06660 [old locus tag: SAUSA300_1229 ]
  • pan locus tag?: SAUPAN003703000
  • symbol: SAUSA300_RS06660
  • pan gene symbol?:
  • synonym:
  • product: HAD family phosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS06660 [old locus tag: SAUSA300_1229 ]
  • symbol: SAUSA300_RS06660
  • product: HAD family phosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 1346711..1347514
  • length: 804
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (1346711..1347514) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACAAATTATAAAGTTGTCGTTTTAGATATGGATGACACATTGCTAAATTCAGATAAT
    GTGATATCAGAAGAAACTGCAAATTATTTAACAGCAATTCAAGATGAAGGTTATTATGTT
    GTTCTAGCATCTGGTAGACCTACTGAAGGTATGATTCCAACTGCTAGAGATTTAAAATTA
    CCTGAACATCATAGCTATATTATTAGTTATAACGGTAGTAAAACGATTAACATGACTAAT
    GAAGAAGTAGAAGTAAGTAAATCGATTGGTAAGCAAGATTTCGATGAAATTGTAGATTAT
    TGTCGAGATAGAGGCTTTTTCGTTCTTACATATCATGATGGTCAAATTATTTACGACAGC
    GAACATGAGTATATGAATATTGAAGCAGAATTAACAGGTTTACCGATGAAACGTGTTGAT
    GATATCAAAGCGTATATTCAAGGCGATGTACCCAAGGTCATGGGTGTAGATTATGTAGCG
    AATATTACAGAAGCTAGAATTGATTTGAATGGTGTGTTCAATGATAATGTAGATGCTACG
    ACAAGTAAGCCATTCTTCTTAGAATTTATGGCCAAAGACGTTTCAAAAGGTAATGCAATT
    AAAGCGTTATGTCACAAATTGGGATATTCGGTGGATCAAGTCATTGCTTTTGGTGATAGT
    ATGAATGATAAATCAATGTTTGAAGTCGCAGGTCTAGCTATTGCTATGGGGAATGCATCA
    GATGAACTTAAGCAATATGCAAATGAAGTTACGTTGGATCATAATGAAAATGGTATTCCA
    CATGCGCTCAAAAAATTGTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    804

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS06660 [old locus tag: SAUSA300_1229 ]
  • symbol: SAUSA300_RS06660
  • description: HAD family phosphatase
  • length: 267
  • theoretical pI: 4.32652
  • theoretical MW: 29821.4
  • GRAVY: -0.271536

Function[edit source | edit]

  • reaction:
    EC 3.8.1.-?  ExPASy
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 186.2)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 86.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIB (TIGR01484; HMM-score: 84.9)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 81.5)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 50.4)
    sucrose-phosphate synthase, sucrose phosphatase-like domain (TIGR02471; HMM-score: 34.9)
    Unknown functionGeneralmannosyl-3-phosphoglycerate phosphatase homolog (TIGR02463; EC 3.1.3.-; HMM-score: 33.1)
    phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 33)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 32.8)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 32.3)
    MetabolismAmino acid biosynthesisSerine familyphosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 30.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 26.2)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IB (TIGR01490; HMM-score: 23.9)
    Unknown functionEnzymes of unknown specificityHAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 22.9)
    MetabolismEnergy metabolismAnaerobicphenylphosphate carboxylase, delta subunit (TIGR02726; HMM-score: 22.6)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 22.3)
    hemimethylated DNA binding domain (TIGR02097; HMM-score: 16.6)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 16)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 15.4)
    heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 14.7)
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 14.6)
    Cellular processesCellular processesAdaptations to atypical conditionstrehalose-phosphatase (TIGR00685; EC 3.1.3.12; HMM-score: 12.8)
    Cellular processesCellular processesDetoxificationcopper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 11.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 219.5)
    S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 57)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 27.8)
    HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 24.4)
    Trehalose_PPase; Trehalose-phosphatase (PF02358; HMM-score: 19.8)
    DUF2608; Protein of unknown function (DUF2608) (PF11019; HMM-score: 18.3)
    HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 17.2)
    no clan definedYccV-like; Hemimethylated DNA-binding protein YccV like (PF08755; HMM-score: 15.9)
    HAD (CL0137) Acid_phosphat_B; HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767; HMM-score: 14.5)
    no clan definedTMEM240; TMEM240 family (PF15207; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.139
    • Ymax_pos: 25
    • Cmax: 0.143
    • Cmax_pos: 24
    • Smax: 0.222
    • Smax_pos: 21
    • Smean: 0.118
    • D: 0.131
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446108458 NCBI
  • RefSeq: WP_000186313 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKLPEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDSEHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDATTSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNASDELKQYANEVTLDHNENGIPHALKKLL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS06660 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]