From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS09615 [old locus tag: SAUSA300_1757 ]
  • pan locus tag?: SAUPAN004566000
  • symbol: SAUSA300_RS09615
  • pan gene symbol?: splB
  • synonym:
  • product: serine protease SplB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS09615 [old locus tag: SAUSA300_1757 ]
  • symbol: SAUSA300_RS09615
  • product: serine protease SplB
  • replicon: chromosome
  • strand: -
  • coordinates: 1942116..1942838
  • length: 723
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (1942116..1942838) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAACAAAAACGTAGTCATCAAGAGTTTAGCAGCATTAACAATTTTAACATCTGTAACA
    GGTATTGGAACAACATTGGTTGAGGAAGTACAACAAACTGCCAAAGCAGAAAATAATGTC
    ACAAAAGTTAAAGATACTAATATTTTTCCATATACTGGTGTAGTTGCTTTTAAAAGTGCA
    ACTGGATTTGTAGTTGGAAAGAATACTATTTTAACAAATAAACATGTGTCGAAAAATTAC
    AAAGTGGGCGATCGTATTACTGCACATCCAAATAGTGATAAAGGTAATGGTGGTATTTAT
    TCGATTAAAAAGATTATTAATTATCCAGGTAAAGAAGATGTATCAGTCATTCAAGTTGAA
    GAGCGTGCAATAGAACGTGGACCAAAAGGCTTTAATTTTAATGATAATGTAACGCCATTC
    AAATATGCGGCAGGGGCTAAAGCTGGTGAGCGAATTAAAGTGATTGGTTATCCACACCCA
    TACAAAAATAAATATGTTTTATATGAGTCAACTGGCCCTGTGATGTCAGTAGAAGGTAGC
    AGTATTGTATATTCAGCGCATACTGAAAGCGGAAACTCTGGATCACCTGTATTAAACAGC
    AACAACGAATTAGTTGGTATTCATTTTGCTTCTGATGTAAAAAATGATGATAACAGAAAT
    GCATATGGCGTCTACTTTACACCAGAAATTAAAAAATTCATTGCAGAAAACATAGATAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    723

Protein[edit source | edit]

Protein Data Bank: 2VID
Protein Data Bank: 4K1S
Protein Data Bank: 4K1T

General[edit source | edit]

  • locus tag: SAUSA300_RS09615 [old locus tag: SAUSA300_1757 ]
  • symbol: SAUSA300_RS09615
  • description: serine protease SplB
  • length: 240
  • theoretical pI: 9.68796
  • theoretical MW: 26096.3
  • GRAVY: -0.359167

Function[edit source | edit]

  • reaction:
    EC 3.4.21.19?  ExPASy
    Glutamyl endopeptidasePreferential cleavage: Glu-|-Xaa, Asp-|-Xaa
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesperiplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 18.5)
    Signal transductionRegulatory functionsProtein interactionsperiplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 18.5)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidespeptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 16.7)
    Genetic information processingProtein fateProtein folding and stabilizationpeptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 16.7)
  • TheSEED:
  • PFAM:
    Peptidase_PA (CL0124) Trypsin; Trypsin (PF00089; HMM-score: 93.2)
    Trypsin_2; Trypsin-like peptidase domain (PF13365; HMM-score: 58.2)
    Peptidase_S7; Peptidase S7, Flavivirus NS3 serine protease (PF00949; HMM-score: 26.5)
    Peptidase_S46; Peptidase S46 (PF10459; HMM-score: 24.9)
    Peptidase_S32; Equine arteritis virus serine endopeptidase S32 (PF05579; HMM-score: 22.1)
    DUF31; Putative peptidase (DUF31) (PF01732; HMM-score: 17.2)
    Peptidase_S39; Peptidase S39 (PF02122; HMM-score: 16.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.672
    • Ymax_pos: 37
    • Cmax: 0.651
    • Cmax_pos: 37
    • Smax: 0.856
    • Smax_pos: 2
    • Smean: 0.779
    • D: 0.714
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446962191 NCBI
  • RefSeq: WP_001039447 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKNVVIKSLAALTILTSVTGIGTTLVEEVQQTAKAENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS09615 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]