From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10705 [old locus tag: SAUSA300_1951 ]
  • pan locus tag?: SAUPAN001403000
  • symbol: SAUSA300_RS10705
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS10705 [old locus tag: SAUSA300_1951 ]
  • symbol: SAUSA300_RS10705
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2112764..2113000
  • length: 237
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2112764..2113000) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAATAACCGCGAACAAATCGAACAATCAGTTATCAGTGCTAGCGCGTATAACGGCAAT
    GACACAGAGGGATTGCTAAAAGAGATTGAAGACGTGTATAAGAAAGCGCAAGCGTTTGAT
    GAAATTCGCGAAGCTATTAATGCGCAATGGGTTGAGTATCCAGAAGACTGGGCGTCAGAG
    GTTTTGAGAGAAGTAAGAGAGCTTGAATATGAGGAGGAACAGGAAAATGAAAATTAA
    60
    120
    180
    237

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS10705 [old locus tag: SAUSA300_1951 ]
  • symbol: SAUSA300_RS10705
  • description: hypothetical protein
  • length: 78
  • theoretical pI: 3.76693
  • theoretical MW: 9226.82
  • GRAVY: -1.10256

Function[edit source | edit]

  • TIGRFAM:
    hercynine metabolism small protein (TIGR04374; HMM-score: 15.1)
    PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family (TIGR04063; EC 2.4.-.-; HMM-score: 14.1)
  • TheSEED:
  • PFAM:
    no clan definedDUF1024; Protein of unknown function (DUF1024) (PF06260; HMM-score: 93.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 39
    • Cmax: 0.136
    • Cmax_pos: 39
    • Smax: 0.133
    • Smax_pos: 2
    • Smean: 0.078
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446987845 NCBI
  • RefSeq: WP_001065101 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEIREAINAQWVEYPEDWASEVLREVRELEYEEEQENEN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS10705 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]