Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS11330 [old locus tag: SAUSA300_2057 ]
  • pan locus tag?: SAUPAN005393000
  • symbol: SAUSA300_RS11330
  • pan gene symbol?: atpC
  • synonym:
  • product: ATP synthase epsilon chain

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS11330 [old locus tag: SAUSA300_2057 ]
  • symbol: SAUSA300_RS11330
  • product: ATP synthase epsilon chain
  • replicon: chromosome
  • strand: -
  • coordinates: 2220517..2220921
  • length: 405
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2220517..2220921) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAATACATTAAACCTAGATATTGTCACTCCTAATGGTTCTGTTTACAATCGTGATAAT
    GTTGAACTCGTTGTTATGCAAACAACAGCTGGTGAGATAGGTGTCATGAGTGGACATATT
    CCAACTGTAGCTGCTTTAAAAACAGGCTTTGTAAAAGTGAAATTTCACGATGGAACTGAA
    TATATTGCTGTAAGCGATGGCTTTGTTGAAGTTAGAAAAGATAAAGTTTCAATCATTGTT
    CAGACTGCAGAAACTGCAAGAGAAATTGATGTTGAAAGAGCTAAATTAGCCAAAGCAAGA
    GCAGAGTCTCACTTGGAAAATGATGACGACAATACTGATATTCATAGAGCCGAAAGAGCT
    TTAGAGAGAGCAAATAACCGTTTGCGTGTGGCTGAATTAAAATAG
    60
    120
    180
    240
    300
    360
    405

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS11330 [old locus tag: SAUSA300_2057 ]
  • symbol: SAUSA300_RS11330
  • description: ATP synthase epsilon chain
  • length: 134
  • theoretical pI: 5.65749
  • theoretical MW: 14843.6
  • GRAVY: -0.353731

Function[edit source | edit]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPaseATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F1, epsilon subunit (TIGR01216; EC 3.6.3.14; HMM-score: 120.2)
    alternate F1F0 ATPase, F1 subunit epsilon (TIGR03166; EC 3.6.3.-; HMM-score: 46.4)
    PRTRC system protein A (TIGR03735; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    no clan definedATP-synt_DE_N; ATP synthase, Delta/Epsilon chain, beta-sandwich domain (PF02823; HMM-score: 88.6)
    ATP-synt_DE; ATP synthase, Delta/Epsilon chain, long alpha-helix domain (PF00401; HMM-score: 51.6)
    DUF2016; Domain of unknown function (DUF2016) (PF09436; HMM-score: 15)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 47
    • Cmax: 0.123
    • Cmax_pos: 47
    • Smax: 0.195
    • Smax_pos: 44
    • Smean: 0.121
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447017138 NCBI
  • RefSeq: WP_001094394 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTEYIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERALERANNRLRVAELK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS11330 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]