Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12975 [old locus tag: SAUSA300_2350 ]
  • pan locus tag?: SAUPAN005937000
  • symbol: SAUSA300_RS12975
  • pan gene symbol?:
  • synonym:
  • product: glutathione S-transferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS12975 [old locus tag: SAUSA300_2350 ]
  • symbol: SAUSA300_RS12975
  • product: glutathione S-transferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2527584..2528051
  • length: 468
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2527584..2528051) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGACGATTAAAGTTGAAGATAATAAAATTATTTTTTCAAGAACGATAGAAGCACCGATT
    GAAAAGGTGTTTGATGCCTATACGACAAAAGCATTATTTGAAAAATGGTTTCATCCAAAA
    GACGCTAGTACCAAAGTGTTTCGCTTTAATGCTGTTTCAGGCGGTGATGCATTTTATGCG
    ATTAAAACACCTACAATGACCAGCTATACATTAGCAGAATATAAAACGGTTAAGCGTCCA
    TATTTAATTGAATATATTGACTCATTTGCGACACCTCAAGGTGCAAAAGATACAAAAATG
    CCAAGCATGAAAATTACTTTGTCATTTTCCAAGAGCAATACAACGAAAACGACAGTGACA
    TCAACATCGGTATTTCCAACAAAAGAAGCCGCTCAACAAGTCATAAACATGGGTGTTGAA
    CAAGGTATGAATCAAACTTTAGATCAACTTGATGCTTTATTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    468

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS12975 [old locus tag: SAUSA300_2350 ]
  • symbol: SAUSA300_RS12975
  • description: glutathione S-transferase
  • length: 155
  • theoretical pI: 9.7192
  • theoretical MW: 17418.9
  • GRAVY: -0.302581

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Bet_V_1_like (CL0209) AHSA1; Activator of Hsp90 ATPase homolog 1-like protein (PF08327; HMM-score: 79.8)
    Polyketide_cyc2; Polyketide cyclase / dehydrase and lipid transport (PF10604; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 11
    • Cmax: 0.128
    • Cmax_pos: 43
    • Smax: 0.181
    • Smax_pos: 2
    • Smean: 0.127
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446075489 NCBI
  • RefSeq: WP_000153344 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYAIKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVTSTSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS12975 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]