COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA_RS00130 [old locus tag: SAP028 ]
• pan locus tag^?:
• symbol: SA_RS00130
• pan gene symbol^?: —
• synonym:
• product: transcriptional regulator

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA_RS00130 [old locus tag: SAP028 ]
• symbol: SA_RS00130
• product: transcriptional regulator
• replicon: pN315
• strand: +
• coordinates: 22517..22756
• length: 240
• essential: unknown

⊟Accession numbers

• Location: NC_003140 (22517..22756) NCBI
• BioCyc: G1G21-2936 BioCyc
• MicrobesOnline: see SAP028

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGAAATTAGCTGAAGCTATAAAAGAACAGAGAGAATTAAAAAGATGGTCTCAAGAGGAA
  TTAGCCAATATATTAAAGGTTTCCAGACAAAGTGTTTCTAAATGGGAAAGTGCCAAAAAC
  TATCCTTCCTTAGATATTTTGATTGCTATGAGCGATTTATTTGGAATCTCTTTAGAGCAT
  TTAATTAAAGGAGATGCACGTTTTAAAAAAGTTATTTTAGAGGGAAATTATAGAGAGTAA
  60
  120
  180
  240
  

⊟Protein

⊟General

• locus tag: SA_RS00130 [old locus tag: SAP028 ]
• symbol: SA_RS00130
• description: transcriptional regulator
• length: 79
• theoretical pI: 9.63142
• theoretical MW: 9191.6
• GRAVY: -0.444304

⊟Function

• TIGRFAM:
  Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 37)
  and 4 more
  putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 27.4)
  Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 24.6)
  RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16.6)
  Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 15.1)
• TheSEED: see SAP028
• PFAM:
  HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 57.8)
  HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46.6)
  and 16 more
  HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 34.8)
  Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 28)
  HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.7)
  HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 20.9)
  HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 18.8)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.1)
  P22_Cro; DNA-binding transcriptional regulator Cro (PF14549; HMM-score: 17.4)
  YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 17.1)
  Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.9)
  HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.4)
  HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.5)
  HTH_11; HTH domain (PF08279; HMM-score: 14.5)
  HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.1)
  HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 13.8)
  Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 13.6)
  DUF1323; Putative transcription regulator (DUF1323) (PF07037; HMM-score: 13)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 7.5
  • Cytoplasmic Membrane Score: 1.15
  • Cellwall Score: 0.62
  • Extracellular Score: 0.73
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.002086
  • TAT(Tat/SPI): 0.000403
  • LIPO(Sec/SPII): 0.000407
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 487758923 NCBI
• RefSeq: WP_001838796 NCBI
• UniProt: see SAP028

⊟Protein sequence

• MKLAEAIKEQRELKRWSQEELANILKVSRQSVSKWESAKNYPSLDILIAMSDLFGISLEHLIKGDARFKKVILEGNYRE

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications