Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00825 [old locus tag: SA0131 ]
  • pan locus tag?: SAUPAN000948000
  • symbol: SA_RS00825
  • pan gene symbol?: deoD1
  • synonym:
  • product: purine-nucleoside phosphorylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00825 [old locus tag: SA0131 ]
  • symbol: SA_RS00825
  • product: purine-nucleoside phosphorylase
  • replicon: chromosome
  • strand: +
  • coordinates: 150926..151633
  • length: 708
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (150926..151633) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATCAACACCACACATTAAACCAATGAATGACGTCGAAATTGCAGAAACGGTTCTA
    TTGCCAGGAGATCCGTTAAGAGCTAAGTTCATTGCAGAAACTTATTTGGATGATGTGGAA
    CAGTTCAATACAGTGCGAAACATGTTTGGTTTTACCGGAACATATAAAGGTAAAAAAGTT
    TCTGTCATGGGTTCAGGTATGGGTATGCCATCTATTGGCATTTACTCTTATGAATTAATT
    CATACATTTGGTTGTAAAAAATTAATTCGCGTTGGCTCTTGTGGCGCGATGCAAGAAAAC
    ATTGATTTATATGATGTGATTATTGCACAAGGTGCCTCTACTGATTCAAATTACGTTCAA
    CAATATCAATTACCAGGTCATTTTGCGCCAATTGCTTCTTATCAATTATTAGAAAAAGCA
    GTTGAAACAGCACGTGACAAAGGTGTACGTCATCATGTAGGTAATGTGTTATCAAGTGAT
    ATTTTCTATAACGCGGATACAACAGCGAGTGAACGTTGGATGCGTATGGGTATTTTAGGT
    GTAGAAATGGAATCAGCTGCATTATACATGAATGCAATTTACGCTGGTGTCGAAGCATTA
    GGTGTGTTCACAGTGAGCGATCATTTAATTCATGAAACGTCAACAACACCTGAGGAAAGG
    GAACGTGCATTTACAGATATGATTGAAATTGCACTGTCATTGGTGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    708

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00825 [old locus tag: SA0131 ]
  • symbol: SA_RS00825
  • description: purine-nucleoside phosphorylase
  • length: 235
  • theoretical pI: 4.9407
  • theoretical MW: 25991.5
  • GRAVY: -0.0493617

Function[edit source | edit]

  • reaction:
    EC 2.4.2.1?  ExPASy
    Purine-nucleoside phosphorylasePurine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphatePurine deoxynucleoside + phosphate = purine + 2'-deoxy-alpha-D-ribose 1-phosphate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidespurine nucleoside phosphorylase (TIGR00107; EC 2.4.2.1; HMM-score: 297.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine phosphorylase (TIGR01718; EC 2.4.2.3; HMM-score: 117.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesMTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 30.2)
    MetabolismCentral intermediary metabolismOtherMTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 30.2)
    futalosine hydrolase (TIGR03664; EC 3.2.2.26; HMM-score: 29.5)
    hopanoid-associated phosphorylase (TIGR03468; HMM-score: 25.6)
    putative AMP nucleosidase (TIGR01721; HMM-score: 24)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine phosphorylase (TIGR01719; EC 2.4.2.3; HMM-score: 20.5)
  • TheSEED:
  • PFAM:
    PUP (CL0408) PNP_UDP_1; Phosphorylase superfamily (PF01048; HMM-score: 136)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 29
    • Cmax: 0.136
    • Cmax_pos: 29
    • Smax: 0.164
    • Smax_pos: 5
    • Smean: 0.109
    • D: 0.114
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446766036 NCBI
  • RefSeq: WP_000843292 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKSTPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTVRNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLYDVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAVETARDKGVRHHVGNVLSSDIFYNADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERERAFTDMIEIALSLV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00825 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]