From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01645 [old locus tag: SA0282 ]
  • pan locus tag?: SAUPAN001199000
  • symbol: SA_RS01645
  • pan gene symbol?: esaG
  • synonym:
  • product: TIGR01741 family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS01645 [old locus tag: SA0282 ]
  • symbol: SA_RS01645
  • product: TIGR01741 family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 340566..341057
  • length: 492
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (340566..341057) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACATTTGAAGAGAAGCTTAGCAAAATATACAATGAAATTGCGAATGAGATTAGCAAT
    ATGATACCGGTAGAGTGGGAAAAAGTATATACAATGGCTTATATAGATGATGGAGGAGGG
    GAGGTATTCTTTAATTATACTAAGCCAGGTAGTGATGACTTGAATTATTACACCGATATA
    CCTAAGGAGTATAACATTTCTGTGCAAGTATTTGATGATTTATGGATGGATTTATATGAT
    TTGTTTGAGGAGTTAAGAGATTTATTTAAAGAAGAAGATTTAGAACCATGGACATCATGT
    GAATTTGACTTTACAAGAGAGGGTAAATTGAAAGTATCATTTGATTATATAGATTGGATA
    AATACAGAGTTTGATCAATTGGGCCGTGAAAATTATTATATGTACAAAAAATTTGGGGTT
    ATACCAGAAATGGAATATGAAATGGAGGAGGTTAAACAAATCGAGCAATATATTAAAGAG
    CAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS01645 [old locus tag: SA0282 ]
  • symbol: SA_RS01645
  • description: TIGR01741 family protein
  • length: 163
  • theoretical pI: 3.80294
  • theoretical MW: 19871
  • GRAVY: -0.710429

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    conserved hypothetical protein (TIGR01741; HMM-score: 262.2)
  • TheSEED:
  • PFAM:
    no clan definedDUF600; Protein of unknown function, DUF600 (PF04634; HMM-score: 175.9)
    DUF1031; Protein of unknown function (DUF1031) (PF06275; HMM-score: 13.6)
    Chalcone-like (CL0560) Chalcone; Chalcone-flavanone isomerase (PF02431; HMM-score: 11.5)
    no clan definedRTX; RTX N-terminal domain (PF02382; HMM-score: 10)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 11
    • Cmax: 0.111
    • Cmax_pos: 27
    • Smax: 0.123
    • Smax_pos: 5
    • Smean: 0.094
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446064189 NCBI
  • RefSeq: WP_000142044 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTFEEKLSKIYNEIANEISNMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDIPKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVIPEMEYEMEEVKQIEQYIKEQEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS01645 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]