From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03190 [old locus tag: SA0552 ]
  • pan locus tag?: SAUPAN002438000
  • symbol: SA_RS03190
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS03190 [old locus tag: SA0552 ]
  • symbol: SA_RS03190
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 645628..646068
  • length: 441
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (645628..646068) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAATTTAGAATTTAACATTGCCGTGCATGTATTAGCTTTTTTAACTAAGCATCATTCA
    GAAAAATTCAATAGTAGTTCATTAGCAGAATTAACTTGTTTAAATCCTGTTCAATTACGA
    CGCGTGACGACTCAACTTGTCGATTTAAAAATGATTGACACAATACGAGGTAAAGATGGC
    GGTTATTTAGCAAATGATCAAAGTGCTGATGTCTCTCTAGCAACATTATATAAACATTTT
    GTCTTAGAGAAAGAACACCACACACGTCTATTTACTGGCGACGAAGGCAGTCACTGTCAA
    ATTGCTCGTAATATTGCAACTACCATGTCACATTATCAGCAAGACGAACAGAATATCATT
    ATTAATTTTTATAATGAAAAAACAATCAAAGATGTCATTGAAGACATTCAAAAGGAGGAT
    TTATGTCATGAAAACATATGA
    60
    120
    180
    240
    300
    360
    420
    441

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS03190 [old locus tag: SA0552 ]
  • symbol: SA_RS03190
  • description: transcriptional regulator
  • length: 146
  • theoretical pI: 6.01033
  • theoretical MW: 16770.8
  • GRAVY: -0.389041

Function[edit source | edit]

  • TIGRFAM:
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 39.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system regulator (TIGR02944; HMM-score: 32.8)
    Signal transductionRegulatory functionsDNA interactionsFeS assembly SUF system regulator (TIGR02944; HMM-score: 32.8)
    and 2 more
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 21.5)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 21.5)
  • TheSEED:
  • PFAM:
    HTH (CL0123) Rrf2; Transcriptional regulator (PF02082; HMM-score: 54.7)
    and 3 more
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 15.4)
    Put_DNA-bind_N; Putative DNA-binding protein N-terminus (PF06971; HMM-score: 14.5)
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 14.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.187
    • Ymax_pos: 23
    • Cmax: 0.134
    • Cmax_pos: 23
    • Smax: 0.313
    • Smax_pos: 13
    • Smean: 0.236
    • D: 0.206
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446969982 NCBI
  • RefSeq: WP_001047238 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDGGYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNIIINFYNEKTIKDVIEDIQKEDLCHENI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS03190 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]