Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03235 [old locus tag: SA0559 ]
  • pan locus tag?: SAUPAN002467000
  • symbol: SA_RS03235
  • pan gene symbol?:
  • synonym:
  • product: N-acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS03235 [old locus tag: SA0559 ]
  • symbol: SA_RS03235
  • product: N-acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 652698..653174
  • length: 477
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (652698..653174) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTCAAGGTAAGACAAGCAACTGAAAAAGATGTTGTTCAAATTAGAGATGTCGCAACT
    AAAGCTTGGTTTAATACATACTTAAATATATACGCTGCGACAACAGTTAATCACTTGTTA
    GAAGCTTCATATAATGAACATCATTTAAAGAAAAGACTTCAAGAACAATTATTCTTAGTC
    GTTGAAGAAGGTAATGACATCGTTGGCTTTGCTAACTTTATTTACGGTGAAGAATTATAT
    TTATCAGCTCATTATGTTAAACCAGAATCGCAACATACAGGTTATGGTACAGCATTGTTA
    AATGAAGGATTATCACGTTTTGAAGATAAATTTGAAGGTGTTTACTTAGAAGTAGATAAT
    AAAAATGAAGAAGCAGTAGCTTACTATAAAGAGCAAGGTTTTACAATCTTACGCTCTTAT
    CAGCCAGAAATGTATGGCGAAAAGTTAGACTTAGCACTTATGTACAAAGCATTTTAA
    60
    120
    180
    240
    300
    360
    420
    477

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS03235 [old locus tag: SA0559 ]
  • symbol: SA_RS03235
  • description: N-acetyltransferase
  • length: 158
  • theoretical pI: 4.88963
  • theoretical MW: 18413.6
  • GRAVY: -0.403797

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 46.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsmycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 26)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 24.9)
    GNAT-family acetyltransferase TIGR03103 (TIGR03103; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 52)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 51.4)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 41.3)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 20)
    FR47; FR47-like protein (PF08445; HMM-score: 17)
    Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 15.5)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 14)
    Thioredoxin (CL0172) Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 13.1)
    Acetyltrans (CL0257) Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.146
    • Ymax_pos: 33
    • Cmax: 0.231
    • Cmax_pos: 33
    • Smax: 0.174
    • Smax_pos: 31
    • Smean: 0.099
    • D: 0.127
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446399650 NCBI
  • RefSeq: WP_000477505 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYNEHHLKKRLQEQLFLVVEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGLSRFEDKFEGVYLEVDNKNEEAVAYYKEQGFTILRSYQPEMYGEKLDLALMYKAF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS03235 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]