From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03365 [old locus tag: SA0584 ]
  • pan locus tag?: SAUPAN002501000
  • symbol: SA_RS03365
  • pan gene symbol?: mnhG2
  • synonym:
  • product: cation:proton antiporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS03365 [old locus tag: SA0584 ]
  • symbol: SA_RS03365
  • product: cation:proton antiporter
  • replicon: chromosome
  • strand: +
  • coordinates: 675352..675810
  • length: 459
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (675352..675810) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGGTGGGGGGCATGTGTTTAATGGAAATAACAAAAGAAATCTTTAGTCTTATTGCTGCT
    GTGATGTTGTTGTTAGGTAGTTTTATTGCTCTTATTAGTGCAATAGGTATCGTGAAATTC
    CAAGATGTTTTCTTAAGAAGTCACGCTGCGACAAAAAGTTCAACTTTATCCGTGTTATTA
    ACTTTAATCGGTGTATTAATTTATTTTATTGTGAATACAGGATTTTTCAGTGTGCGTTTA
    TTACTGTCACTTGTTTTTATTAATTTAACTTCACCAGTCGGCATGCACTTAGTCGCTCGC
    GCTGCTTATCGCAACGGCGCTTATATGTATCGAAAAAATGATGCTCACACACATGCATCA
    ATATTATTAAGTTCAAATGAACAAAACTCTACAGAAGCATTACAATTACGTGCTAAAAAA
    CGAGAAGAGCATCGTAAGAAATGGTATCAAAACGATTGA
    60
    120
    180
    240
    300
    360
    420
    459

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS03365 [old locus tag: SA0584 ]
  • symbol: SA_RS03365
  • description: cation:proton antiporter
  • length: 152
  • theoretical pI: 10.2997
  • theoretical MW: 16994
  • GRAVY: 0.415132

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmonovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 89.9)
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 15.8)
  • TheSEED:
  • PFAM:
    no clan definedPhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 78.4)
    CCB1; Cofactor assembly of complex C subunit B (PF12046; HMM-score: 15.5)
    DUF4029; Protein of unknown function (DUF4029) (PF13221; HMM-score: 9.8)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 8.7)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 41
    • Cmax: 0.162
    • Cmax_pos: 50
    • Smax: 0.232
    • Smax_pos: 12
    • Smean: 0.134
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_072353857 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVGGMCLMEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNEQNSTEALQLRAKKREEHRKKWYQND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS03365 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]