From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04605 [old locus tag: SA0808 ]
  • pan locus tag?: SAUPAN003048000
  • symbol: SA_RS04605
  • pan gene symbol?: mnhF
  • synonym:
  • product: Na+/H+ antiporter subunit F

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS04605 [old locus tag: SA0808 ]
  • symbol: SA_RS04605
  • product: Na+/H+ antiporter subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 912700..912993
  • length: 294
  • essential: unknown

⊟Accession numbers[edit source | edit]

  • Location: NC_002745 (912700..912993) NCBI
  • MicrobesOnline:

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
    ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
    ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
    ATGATTGTCGTTATTATGATGATTGGTATATTAGCCTTTTTAGGTACTGCAGTATTCTCT
    AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG
    60
    120
    180
    240
    294

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SA_RS04605 [old locus tag: SA0808 ]
  • symbol: SA_RS04605
  • description: Na+/H+ antiporter subunit F
  • length: 97
  • theoretical pI: 7.7971
  • theoretical MW: 10616.1
  • GRAVY: 1.3701

⊟Function[edit source | edit]

  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsentry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)
    and 1 more
    TIGR03943 family protein (TIGR03943; HMM-score: 6.5)
  • TheSEED:
  • PFAM:
    no clan definedMrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 49.9)
    and 2 more
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 14.5)
    no clan definedDeltameth_res; Deltamethrin resistance (PF16020; HMM-score: 6.2)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.29
    • Ymax_pos: 33
    • Cmax: 0.404
    • Cmax_pos: 33
    • Smax: 0.26
    • Smax_pos: 31
    • Smean: 0.178
    • D: 0.246
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit source | edit]

  • GI: 446939050 NCBI
  • RefSeq: WP_001016306 NCBI
  • UniProt:

⊟Protein sequence[edit source | edit]

  • MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

  • SA_RS04605 no polycistronic organisation predicted

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "https://aureowiki.med.uni-greifswald.de/index.php?title=SA_RS04605&oldid=79840"