Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07020 [old locus tag: SA1236 ]
  • pan locus tag?: SAUPAN003820000
  • symbol: SA_RS07020
  • pan gene symbol?: acyP
  • synonym:
  • product: acylphosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS07020 [old locus tag: SA1236 ]
  • symbol: SA_RS07020
  • product: acylphosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 1409674..1409943
  • length: 270
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1409674..1409943) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTT
    ACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTAT
    GTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATT
    GAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAAT
    CAAAAATTATCGGATTTTCGATCAATATAA
    60
    120
    180
    240
    270

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS07020 [old locus tag: SA1236 ]
  • symbol: SA_RS07020
  • description: acylphosphatase
  • length: 89
  • theoretical pI: 4.71273
  • theoretical MW: 10160.3
  • GRAVY: -0.270787

Function[edit source | edit]

  • reaction:
    EC 3.6.1.7?  ExPASy
    AcylphosphataseAn acylphosphate + H2O = a carboxylate + phosphate
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repaircarbamoyltransferase HypF (TIGR00143; HMM-score: 50.2)
  • TheSEED:
  • PFAM:
    Acylphosphatase (CL0622) Acylphosphatase; Acylphosphatase (PF00708; HMM-score: 80.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 26
    • Cmax: 0.125
    • Cmax_pos: 26
    • Smax: 0.174
    • Smax_pos: 23
    • Smean: 0.121
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447138651 NCBI
  • RefSeq: WP_001215907 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS07020 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]