From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07135 [old locus tag: SA1258 ]
  • pan locus tag?: SAUPAN003857000
  • symbol: SA_RS07135
  • pan gene symbol?: fakB2
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS07135 [old locus tag: SA1258 ]
  • symbol: SA_RS07135
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1431052..1431891
  • length: 840
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1431052..1431891) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACAAAACAGATTATAGTAACAGACTCAACATCCGATTTATCTAAAGAATACTTAGAA
    GCAAACAACATTCATGTAATTCCTTTAAGTTTAACTATTGAAGGAGCTTCATACGTTGAC
    CAAGTAGATATTACATCAGAAGAATTTATTAATCATATTGAAAATGATGAAGATGTAAAG
    ACAAGTCAGCCAGCCATAGGTGAATTTATATCTGCTTATGAAGAACTAGGAAAAGATGGC
    TCTGAAATCATAAGTATTCATCTTTCTTCAGGATTAAGTGGTACATATAACACTGCTTAC
    CAAGCAAGTCAAATGGTAGATGCTAATGTAACTGTTATTGATTCAAAATCTATTTCTTTT
    AGTTTAGGGTATCAAATACAACACCTAGTAGAGCTTGTAAAAGAAGGTGTCTCAACTTCT
    GAAATAGTTAAAAAGTTAAATCATTTAAGAGAAAACATTAAATTATTTGTAGTTATAGGG
    CAATTGAATCAATTAATTAAAGGTGGCAGAATTAGTAAAACAAAAGGTTTGATTGGTAAT
    CTTATGAAAATTAAACCAATTGGTACACTTGATGATGGTCGCTTAGAGCTTGTGCACAAT
    GCGAGAACTCAAAATTCTAGTATCCAATACTTGAAAAAGGAAATTGCTGAATTTATAGGA
    GATCATGAAATCAAATCCATTGGTGTCGCACATGCTAACGTCATTGAATATGTTGATAAA
    TTGAAGAAAGTTTTTAACGAAGCTTTTCATGTGAATAATTACGATATAAATGTAACTACA
    CCAGTTATTTCTGCACATACTGGTCAAGGTGCGATTGGCCTCGTAGTCCTTAAGAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS07135 [old locus tag: SA1258 ]
  • symbol: SA_RS07135
  • description: hypothetical protein
  • length: 279
  • theoretical pI: 5.7835
  • theoretical MW: 30674.7
  • GRAVY: -0.0935484

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralEDD domain protein, DegV family (TIGR00762; HMM-score: 328.6)
  • TheSEED:
  • PFAM:
    EDD (CL0245) DegV; Uncharacterised protein, DegV family COG1307 (PF02645; HMM-score: 285.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.126
    • Ymax_pos: 47
    • Cmax: 0.122
    • Cmax_pos: 37
    • Smax: 0.204
    • Smax_pos: 35
    • Smean: 0.115
    • D: 0.122
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446088208 NCBI
  • RefSeq: WP_000166063 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISFSLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDKLKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS07135 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]