Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08280 [old locus tag: SA1470 ]
  • pan locus tag?: SAUPAN004250000
  • symbol: SA_RS08280
  • pan gene symbol?: obgE
  • synonym:
  • product: GTPase ObgE

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS08280 [old locus tag: SA1470 ]
  • symbol: SA_RS08280
  • product: GTPase ObgE
  • replicon: chromosome
  • strand: -
  • coordinates: 1678412..1679704
  • length: 1293
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1678412..1679704) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGTTTGTCGATCAAGTCAAAATATCTCTTAAAGCCGGTGATGGTGGTAATGGTATTACC
    GCATATAGAAGAGAAAAATATGTACCATTTGGTGGACCAGCTGGCGGTGACGGTGGTAAA
    GGTGCTTCAGTCGTATTTGAAGTGGATGAAGGTTTAAGAACGTTATTAGATTTTAGATAT
    CAACGTCATTTTAAAGCAAGCAAAGGTGAAAATGGCCAAAGTAGTAATATGCATGGTAAA
    AATGCGGAAGATTTAGTATTAAAAGTTCCACCTGGTACAATTATTAAAAATGTTGAAACA
    GACGAAGTGTTAGCAGATCTTGTTGAAGATGGTCAAAGAGCTGTAGTAGCGAAGGGCGGT
    CGAGGTGGCCGAGGTAATTCACGTTTTGCAACACCTAGAAACCCTGCACCTGACTTCAGT
    GAAAAAGGTGAACCAGGTGAGGAATTAGATGTATCTTTAGAATTGAAATTATTAGCTGAT
    GTAGGATTAGTAGGTTTCCCTAGTGTGGGTAAATCGACTTTATTATCTATCGTTTCAAAA
    GCTAAGCCTAAAATTGGGGCATATCATTTTACAACGATTAAACCAAATCTAGGTGTTGTT
    TCAACGCCTGATCAACGTAGTTTTGTTATGGCAGATTTACCAGGTTTAATTGAAGGTGCA
    TCTGATGGCGTTGGATTAGGACATCAATTTTTAAGACATGTAGAGAGAACAAAAGTTATT
    GTTCACATGATTGATATGAGCGGTTCTGAAGGTAGAGAACCTATTGAAGATTATAAAGTC
    ATTAATCAAGAATTAGCTGCGTACGAGCAACGTTTAGAAGATAGACCTCAAATCGTAGTA
    GCTAACAAGATGGATTTACCTGAATCACAAGATAATTTAAACTTGTTTAAAGAAGAAATT
    GGCGAAGATGTGCCAGTTATTCCAGTTTCAACAATAACGCGTGATAATATTGATCAATTA
    TTATATGCAATAGCAGATAAATTAGAAGAATATAAAGATGTTGACTTCACAGTTGAAGAA
    GAGGAGTCAGTTGGCATTAACCGAGTATTATATAAACATACACCGTCACAAGATAAATTT
    ACAATTTCAAGAGATGATGATGGTGCTTATGTGGTAAGTGGTAATGCTATTGAAAGAATG
    TTTAAAATGACTGACTTTAACAGTGATCCAGCAGTACGTCGATTTGCTCGTCAAATGCGT
    TCGATGGGTATTGATGATGCACTTAGAGAACGTGGTTGTAAAAATGGTGATATCGTTAGA
    ATTCTTGGCGGAGAATTTGAATTCGTTGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1293

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS08280 [old locus tag: SA1470 ]
  • symbol: SA_RS08280
  • description: GTPase ObgE
  • length: 430
  • theoretical pI: 4.79119
  • theoretical MW: 47234.9
  • GRAVY: -0.413488

Function[edit source | edit]

  • reaction:
    EC 3.6.5.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein synthesisOtherObg family GTPase CgtA (TIGR02729; HMM-score: 467.3)
    Obg family GTPase CgtA, C-terminal extension (TIGR03595; HMM-score: 92.8)
    Unknown functionGeneralGTP-binding protein YchF (TIGR00092; HMM-score: 62)
    Unknown functionGeneralGTP-binding protein HflX (TIGR03156; HMM-score: 51.8)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 42.1)
    Genetic information processingProtein synthesisOtherGTP-binding protein Era (TIGR00436; HMM-score: 40.2)
    Genetic information processingProtein synthesisOtherribosome-associated GTPase EngA (TIGR03594; HMM-score: 33)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 24.1)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 21.6)
    translation initiation factor 2, gamma subunit (TIGR03680; HMM-score: 21.6)
    Genetic information processingProtein fateProtein modification and repair[FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 21.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 13.6)
    Genetic information processingProtein synthesisTranslation factorstranslation initiation factor IF-2 (TIGR00487; HMM-score: 13.4)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 11.9)
    Signal transductionRegulatory functionsProtein interactionsLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 11.9)
  • TheSEED:
  • PFAM:
    no clan definedGTP1_OBG; GTP1/OBG (PF01018; HMM-score: 203.8)
    DUF1967; Domain of unknown function (DUF1967) (PF09269; HMM-score: 89.5)
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 83.1)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 40.1)
    Arf; ADP-ribosylation factor family (PF00025; HMM-score: 17.3)
    no clan definedDUF3145; Protein of unknown function (DUF3145) (PF11343; HMM-score: 17.1)
    P-loop_NTPase (CL0023) Gtr1_RagA; Gtr1/RagA G protein conserved region (PF04670; HMM-score: 16.8)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 16.6)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 16.5)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 15.1)
    ABC_tran; ABC transporter (PF00005; HMM-score: 14.4)
    no clan definedMMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 13.8)
    P-loop_NTPase (CL0023) MMR_HSR1_C; GTPase of unknown function C-terminal (PF08438; HMM-score: 13.6)
    NOG1; Nucleolar GTP-binding protein 1 (NOG1) (PF06858; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 70
    • Cmax: 0.12
    • Cmax_pos: 22
    • Smax: 0.129
    • Smax_pos: 2
    • Smean: 0.082
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446418245 NCBI
  • RefSeq: WP_000496100 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRYQRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGGRGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSKAKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVIVHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEIGEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDFTVEEEESVGINRVLYKHTPSQDKFTISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVRILGGEFEFVE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS08280 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]