From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08830 [old locus tag: SA1565 ]
  • pan locus tag?: SAUPAN004411000
  • symbol: SA_RS08830
  • pan gene symbol?:
  • synonym:
  • product: thiol reductase thioredoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS08830 [old locus tag: SA1565 ]
  • symbol: SA_RS08830
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1796269..1796580
  • length: 312
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1796269..1796580) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
    GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
    GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGACAAATTTATGGATATT
    TGTATTGAAAATGGTATTATGGGGATTCCAAGTTTTCTAGTATATAAAAATGGTGAACTG
    CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
    CAATATGTGTAA
    60
    120
    180
    240
    300
    312

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS08830 [old locus tag: SA1565 ]
  • symbol: SA_RS08830
  • description: thiol reductase thioredoxin
  • length: 103
  • theoretical pI: 4.14259
  • theoretical MW: 11855.5
  • GRAVY: -0.168932

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportthioredoxin (TIGR01068; HMM-score: 47.6)
    protein disulfide isomerase (TIGR01130; HMM-score: 26.4)
    Genetic information processingProtein fateProtein folding and stabilizationprotein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)
    Genetic information processingProtein fateProtein folding and stabilizationperiplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)
    Unknown functionGeneralredox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
  • TheSEED:
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 58.1)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 23.9)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 17.6)
    Phosducin; Phosducin (PF02114; HMM-score: 16.2)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 15.3)
    Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 12.5)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 11.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 11
    • Cmax: 0.106
    • Cmax_pos: 34
    • Smax: 0.147
    • Smax_pos: 2
    • Smean: 0.11
    • D: 0.105
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446733907 NCBI
  • RefSeq: WP_000811163 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS08830 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]