From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS09005 [old locus tag: SA1599 ]
  • pan locus tag?: SAUPAN004479000
  • symbol: SA_RS09005
  • pan gene symbol?: tal
  • synonym:
  • product: transaldolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS09005 [old locus tag: SA1599 ]
  • symbol: SA_RS09005
  • product: transaldolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1836897..1837610
  • length: 714
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1836897..1837610) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAACTAAATGTAGAAGTATTTGCGGACGGTGCAGATATTGAAGAAATGAAAGCA
    GCTTATAAAAACAAACAAGTGGATGGTTTTACAACAAATCCTAGTTTAATGGCGAAAGCG
    GGCGTAACAGATTACAAAGCTTTTGCTGAAGAAGCTGTGAAAGAAATTCCAGATGCTTCA
    ATTTCATTTGAAGTATTTGCAGACGATTTAGAAACTATGGAAAAAGAAGCAGCAATTTTA
    AAACAATATGGCGAAAATGTATTTGTTAAAATTCCTATTGTAAATACAAAAGGTGAATCA
    ACGATTCCTTTAATTAAAAAACTTTCAGCTGACAATGTGAGATTAAACGTTACGGCTGTT
    TACACAATTGAACAAGTTAAAGAAATAACTGAAGCAGTAACTGAAGGTGTGCCAACATAT
    GTTTCAGTATTTGCAGGACGTATTGCAGATACAGGCGTAGATCCATTACCATTAATGAAA
    GAGGCTGTAAAAGTTACGCATAGTAAAGACGGCGTTAAATTATTATGGGCAAGTTGCCGC
    GAATTATTCAATGTGATTCAAGCTGATGAAATTGGTGCAGATATTATTACACGCCCTGCA
    GATGTTGTGAAAAAAGTGAATACAAACTTAGGTCGCGATATTAACGAATTATCAGTAGAT
    ACAGTTAAAGGCTTTGCGAAAGATATTCAATCTTCAGGTCTTTCTATTCTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS09005 [old locus tag: SA1599 ]
  • symbol: SA_RS09005
  • description: transaldolase
  • length: 237
  • theoretical pI: 4.51323
  • theoretical MW: 25758.3
  • GRAVY: -0.0244726

Function[edit source | edit]

  • reaction:
    EC 2.2.1.2?  ExPASy
    TransaldolaseSedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-erythrose 4-phosphate + D-fructose 6-phosphate
  • TIGRFAM:
    MetabolismEnergy metabolismPentose phosphate pathwaytransaldolase (TIGR02134; EC 2.2.1.2; HMM-score: 438.7)
    MetabolismEnergy metabolismPentose phosphate pathwayfructose-6-phosphate aldolase (TIGR00875; EC 4.1.2.-; HMM-score: 98.9)
    MetabolismEnergy metabolismPentose phosphate pathwaytransaldolase (TIGR00874; EC 2.2.1.2; HMM-score: 23.8)
    MetabolismEnergy metabolismPentose phosphate pathwaytransaldolase (TIGR00876; EC 2.2.1.2; HMM-score: 22.2)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) TAL_FSA; Transaldolase/Fructose-6-phosphate aldolase (PF00923; HMM-score: 128.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.146
    • Ymax_pos: 50
    • Cmax: 0.182
    • Cmax_pos: 50
    • Smax: 0.2
    • Smax_pos: 19
    • Smean: 0.094
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447019239 NCBI
  • RefSeq: WP_001096495 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAKLNVEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDASISFEVFADDLETMEKEAAILKQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAVYTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMKEAVKVTHSKDGVKLLWASCRELFNVIQADEIGADIITRPADVVKKVNTNLGRDINELSVDTVKGFAKDIQSSGLSIL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS09005 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]