From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10790 [old locus tag: SA1875 ]
  • pan locus tag?: SAUPAN005342000
  • symbol: SA_RS10790
  • pan gene symbol?: acpS
  • synonym:
  • product: holo-ACP synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS10790 [old locus tag: SA1875 ]
  • symbol: SA_RS10790
  • product: holo-ACP synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 2123000..2123359
  • length: 360
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2123000..2123359) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATACATGGAATTGGTGTAGATTTAATCGAAATCGATCGAATAAAAGTGTTATATAGT
    AAGCAGCCAAAATTGGTTGAGCGGATTTTAACTAAAAATGAACAGCACAAATTCAACAAT
    TTCACACATGAGCAACGTAAAATTGAATTTTTAGCTGGCAGGTTTGCTACAAAAGAAGCG
    TTCAGTAAAGCATTAGGCACAGGCTTAGGAAAACATGTAGCTTTTAACGATATAGACTGT
    TACAACGACGAACTTGGCAAACCAAAGATTGATTACGAAGGGTTCATCGTACATGTTAGT
    ATCTCACACACTGAGCATTATGCGATGAGCCAAGTTGTTTTAGAAAAGTCAGCATTTTAA
    60
    120
    180
    240
    300
    360

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS10790 [old locus tag: SA1875 ]
  • symbol: SA_RS10790
  • description: holo-ACP synthase
  • length: 119
  • theoretical pI: 7.80122
  • theoretical MW: 13633.6
  • GRAVY: -0.302521

Function[edit source | edit]

  • reaction:
    EC 2.7.8.7?  ExPASy
    Holo-[acyl-carrier-protein] synthaseCoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier-protein]
    CoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3null,5'-bisphosphate + holo-[acyl-carrier-protein]?
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisholo-[acyl-carrier-protein] synthase (TIGR00516; EC 2.7.8.7; HMM-score: 115.1)
    Genetic information processingProtein fateProtein modification and repairphosphopantetheine--protein transferase domain (TIGR00556; HMM-score: 94.5)
  • TheSEED:
  • PFAM:
    no clan definedACPS; 4'-phosphopantetheinyl transferase superfamily (PF01648; HMM-score: 67.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 37
    • Cmax: 0.106
    • Cmax_pos: 21
    • Smax: 0.166
    • Smax_pos: 33
    • Smean: 0.082
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446503343 NCBI
  • RefSeq: WP_000581197 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS10790 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]