Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS11285 [old locus tag: SA1967 ]
  • pan locus tag?: SAUPAN005508000
  • symbol: SA_RS11285
  • pan gene symbol?: cdaA
  • synonym:
  • product: ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS11285 [old locus tag: SA1967 ]
  • symbol: SA_RS11285
  • product: ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2228184..2228993
  • length: 810
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2228184..2228993) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGATTTTTCCAACTTTTTTCAAAACCTCAGTACGTTAAAAATTGTAACGAGTATCCTT
    GATTTACTGATAGTTTGGTATGTACTTTATCTTCTCATCACGGTCTTTAAGGGAACTAAA
    GCGATACAATTACTTAAAGGGATATTAGTAATTGTTATTGGTCAGCAGATAAGTATGATA
    TTGAACTTGACTGCAACATCTAAATTATTCGATATCGTTATTCAATGGGGGGTATTAGCT
    TTAATAGTAATATTCCAACCAGAAATTAGACGTGCGTTAGAACAACTTGGTAGAGGTAGC
    TTTTTAAAACGCTATACTTCTAATACGTATAGTAAAGATGAAGAGAAATTGATTCAATCG
    GTTTCAAAGGCTGTGCAATATATGGCTAAAAGACGTATAGGTGCATTAATTGTCTTTGAA
    AAAGAAACAGGTCTTCAAGATTATATTGAAACAGGTATTGCAATGGATTCAAATATTTCG
    CAAGAACTTTTAATTAATGTCTTTATACCTAACACACCTTTACATGATGGTGCAATGATT
    ATTCAAGGCACTAAGATTGCAGCAGCAGCAAGTTATTTGCCATTGTCTGATAGTCCTAAG
    ATATCTAAAAGTTTGGGTACAAGACATAGAGCTGCGGTTGGTATTTCAGAAGTATCTGAT
    GCATTTACCGTTATTGTATCTGAAGAAACTGGTGATATTTCGGTAACATTTGATGGAAAA
    TTACGACGAGACATTTCAAACGAAATTTTTGAAGAGTTGCTTGCTGAACATTGGTTTGGC
    ACACGCTTTCAAAAGAAAGGTGTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    810

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS11285 [old locus tag: SA1967 ]
  • symbol: SA_RS11285
  • description: ABC transporter permease
  • length: 269
  • theoretical pI: 9.19244
  • theoretical MW: 30078.9
  • GRAVY: 0.250929

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Hypothetical proteinsConservedTIGR00159 family protein (TIGR00159; HMM-score: 295.4)
  • TheSEED:
  • PFAM:
    no clan definedDisA_N; DisA bacterial checkpoint controller nucleotide-binding (PF02457; HMM-score: 150.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 11
    • Cmax: 0.145
    • Cmax_pos: 42
    • Smax: 0.153
    • Smax_pos: 2
    • Smean: 0.124
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446270041 NCBI
  • RefSeq: WP_000347896 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMILNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQSVSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMIIQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGKLRRDISNEIFEELLAEHWFGTRFQKKGVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS11285 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]