From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12225 [old locus tag: SA2128 ]
  • pan locus tag?: SAUPAN005826000
  • symbol: SA_RS12225
  • pan gene symbol?:
  • synonym:
  • product: MOSC domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS12225 [old locus tag: SA2128 ]
  • symbol: SA_RS12225
  • product: MOSC domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2393413..2394066
  • length: 654
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2393413..2394066) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATATCAATTCACGCAATTTCGACAGGAAAAATCCAAGATTTGCCTTATAGCTCGAAA
    AGACCGATACGCTCTGCTTTAGATAAAACTAAGATTTCACAAACAACATGGTTATCTTCA
    ACTGGTTTCACTGGTGATGAACAGGCTTATAAAGATCATGGTGGACCACATAAAGCAGTT
    TGTGGGTTTAGTAAGCATAATTATGCACTGTATCAAGATGATTTACCTACACTACCTACT
    CATGCGATGTTTGGAGAGAATTTAACATTTGATTATTTAGACGAATCTGATGTTTACTTT
    GGTAATCAATATCGTTTAGGTGAAGCGTTAATTGAGGTTTCTGAAATTAGAGAACCATGC
    TGGAAAATTCAAGCAAAATATAATATTCCTGATTTAGTGAAGCGCATGTCTACATCTGGT
    AAAACAGGTTTCTATTTCCGGGTATTAAAACAAGGCTATGTATCTCCAAATGATCAGCTT
    TACTTAATACAAGAAGCACCAATCGAACATCGTTTATCTGTACAACAGCTTAATGACCTT
    TATTATAATGATAGACAAAATCAAGATATGTTACGATATGCACTAAACAATCCATTTCTG
    TCACCAACAAGACGCGATAAACTTCAAAAAATGTATAACAGAACATTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    654

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS12225 [old locus tag: SA2128 ]
  • symbol: SA_RS12225
  • description: MOSC domain-containing protein
  • length: 217
  • theoretical pI: 8.85989
  • theoretical MW: 25147.3
  • GRAVY: -0.676959

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedMOSC; MOSC domain (PF03473; HMM-score: 48.6)
    3-alpha; 3-alpha domain (PF03475; HMM-score: 29.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.175
    • Ymax_pos: 50
    • Cmax: 0.186
    • Cmax_pos: 50
    • Smax: 0.233
    • Smax_pos: 32
    • Smean: 0.15
    • D: 0.165
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446546094 NCBI
  • RefSeq: WP_000623440 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MISIHAISTGKIQDLPYSSKRPIRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAVCGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPCWKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDLYYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS12225 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]