From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12830 [old locus tag: SA2234 ]
  • pan locus tag?: SAUPAN005997000
  • symbol: SA_RS12830
  • pan gene symbol?: opuCD
  • synonym:
  • product: amino acid ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS12830 [old locus tag: SA2234 ]
  • symbol: SA_RS12830
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2509481..2510176
  • length: 696
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2509481..2510176) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGAAGGTAATTTATTACAGCAATTATTCAATTATTATGTTACGAACTTTGGTTATCTA
    TGGGATTTATTTTTCAAACACTTATTAATGTCTGTCTATGGTGTGCTGTTTGCAGCTTTA
    ATTGGTATTCCATTGGGAATCTTGCTTGCAAGATACACAAAACTTTCTGGATTTGTAATT
    ACAATTGCAAATATAATTCAAACAGTTCCAGTCATTGCAATGTTAGCTATTTTAATGTTA
    GTCATGGGCTTAGGTTCAGAAACAGTAGTTTTAACAGTGTTTTTATATGCGTTACTTCCA
    ATTATAAAAAACACTTATACTGGTATAGCTAGTGTTGATGCGAATATTAAGGATGCTGGC
    AAAGGTATGGGAATGACACGCAATCAAGTGCTACGAATGATTGAATTACCGTTATCTGTT
    TCGGTTATTATCGGTGGCATTCGTATTGCCTTGGTTGTTGCGATAGGTGTTGTTGCCGTT
    GGATCATTTATAGGAGCACCTACGCTTGGTGACATTGTGATTCGTGGTACAAATGCGACG
    GATGGCACAACGTTTATTTTAGCAGGTGCGATTCCGATTGCTATCATTGCAATCGTCATT
    GATGTACTATTAAGATTTTTAGAAAAACGATTAGACCCAACAACACGACATCGTAAAAAT
    CAATCTAATCATCGGCCGCAAAGTATTAATATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS12830 [old locus tag: SA2234 ]
  • symbol: SA_RS12830
  • description: amino acid ABC transporter permease
  • length: 231
  • theoretical pI: 10.1502
  • theoretical MW: 25025.9
  • GRAVY: 0.844156

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 86.1)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, permease protein (TIGR01183; HMM-score: 44.7)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 32.3)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 31.7)
    NifC-like ABC-type porter (TIGR01581; HMM-score: 22)
    2-aminoethylphosphonate ABC transport system, membrane component PhnV (TIGR03255; HMM-score: 19.6)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, permease protein (TIGR02141; HMM-score: 18.4)
    Cellular processesCellular processesPathogenesisautotransporter-associated beta strand repeat (TIGR02601; HMM-score: 10)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingautotransporter-associated beta strand repeat (TIGR02601; HMM-score: 10)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 9.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescelllulose biosynthesis operon protein BcsF/YhjT (TIGR03493; HMM-score: 5.4)
  • TheSEED:
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 78.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 69
    • Cmax: 0.144
    • Cmax_pos: 39
    • Smax: 0.177
    • Smax_pos: 63
    • Smean: 0.059
    • D: 0.094
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446321086 NCBI
  • RefSeq: WP_000398941 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVITIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAGKGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNATDGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS12830 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]