From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13580 [old locus tag: SA2371 ]
  • pan locus tag?: SAUPAN006264000
  • symbol: SA_RS13580
  • pan gene symbol?:
  • synonym:
  • product: type II secretion protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13580 [old locus tag: SA2371 ]
  • symbol: SA_RS13580
  • product: type II secretion protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2661703..2661999
  • length: 297
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2661703..2661999) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGGAAACAATAGGAAGCATTATTTATTTAAAAGAAGGTTCGCAAAAGTTAATGATTATT
    AATAGAGGACCAATTGTAGAAATTGAAAATCAAAAGTATATGTTTGACTATTCTGCATGT
    AAATATCCGATTGGTGTTGTGGAAGATGAAATTTATTATTTTAACGAAGAAAATATAGAT
    TCAGTTATTTTTAAAGGTTATTCTGATCAAGATGAGGTTAGATTTCAAGAGTTGTTTGAA
    AATATGAAACAAAATTTGGATAGTGAAATACAACGTGGAGAAGTTACACCACAATAA
    60
    120
    180
    240
    297

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13580 [old locus tag: SA2371 ]
  • symbol: SA_RS13580
  • description: type II secretion protein
  • length: 98
  • theoretical pI: 4.01648
  • theoretical MW: 11546.9
  • GRAVY: -0.521429

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.3)
  • TheSEED:
  • PFAM:
    no clan definedDUF4176; Domain of unknown function (DUF4176) (PF13780; HMM-score: 84.3)
    HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 14.7)
    GBD (CL0202) CBM_26; C-terminal carbohydrate-binding module (PF16824; HMM-score: 13)
    Peptidase_MH (CL0035) DUF4910; Domain of unknown function (DUF4910) (PF16254; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 29
    • Cmax: 0.108
    • Cmax_pos: 29
    • Smax: 0.121
    • Smax_pos: 18
    • Smean: 0.088
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446369854 NCBI
  • RefSeq: WP_000447709 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENIDSVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTPQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS13580 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]