From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13730 [old locus tag: SA2399 ]
  • pan locus tag?: SAUPAN006305000
  • symbol: SA_RS13730
  • pan gene symbol?: fdaB
  • synonym:
  • product: class I fructose-bisphosphate aldolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13730 [old locus tag: SA2399 ]
  • symbol: SA_RS13730
  • product: class I fructose-bisphosphate aldolase
  • replicon: chromosome
  • strand: +
  • coordinates: 2688007..2688897
  • length: 891
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2688007..2688897) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATAAAGAGCAATTAGAAAAAATGAAAAATGGAAAAGGCTTTATTGCCGCATTAGAC
    CAAAGTGGTGGTAGTACACCAAAAGCACTTAAAGAATATGGTGTAAACGAAGATCAATAT
    AGCAATGAAGACGAAATGTTCCAACTTGTTCACGATATGCGTACACGTGTGGTAACTTCA
    CCTTCATTCTCACCAGATAAAATTTTGGGTGCTATTCTTTTCGAACAAACAATGGATCGC
    GAAGTAGAAGGCAAATACACTGCAGATTACTTAGCTGATAAAGGTGTTGTTCCGTTCTTA
    AAAGTAGACAAAGGTCTTGCTGAAGAGCAAAATGGTGTTCAATTAATGAAACCAATCGAC
    AACTTAGACAGTTTATTAGACCGTGCAAACGAACGTCACATTTTTGGTACAAAAATGCGT
    TCTAACATTTTAGAATTAAATGAGCAAGGTATCAAAGACGTTGTTGAACAACAATTTGAA
    GTTGCTAAACAAATTATTGCTAAAGGTTTAGTGCCAATTATCGAACCAGAAGTTAATATT
    AATGCAAAAGACAAAGCTGAAATTGAAAAAGTATTAAAAGCTGAACTTAAAAAAGGTTTA
    GATAGCTTAAATGCTGATCAATTAGTAATGTTGAAATTAACAATTCCTACTGAACCAAAC
    TTATACAAAGAGTTAGCTGAACATCCTAATGTTGTTCGTGTCGTTGTATTATCAGGTGGT
    TACAGCAGAGAAAAAGCAAATGAATTACTTAAAGATAACGATGAACTTATCGCAAGTTTC
    TCACGTGCATTAGCTAGTGATTTAAGAGCTGATCAATCTAAAGAAGAATTCGATAAAGCT
    TTAGGTGATGCTGTAGAATCAATCTACGACGCATCTGTAAACAAAAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    891

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13730 [old locus tag: SA2399 ]
  • symbol: SA_RS13730
  • description: class I fructose-bisphosphate aldolase
  • length: 296
  • theoretical pI: 4.60428
  • theoretical MW: 33041.3
  • GRAVY: -0.475676

Function[edit source | edit]

  • reaction:
    EC 4.1.2.13?  ExPASy
    Fructose-bisphosphate aldolaseD-fructose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthertyrosine decarboxylase MnfA (TIGR03812; EC 4.1.1.25; HMM-score: 11.7)
  • TheSEED:
  • PFAM:
    Peptidase_MH (CL0035) Glycolytic; Fructose-bisphosphate aldolase class-I (PF00274; HMM-score: 51.9)
    and 3 more
    no clan definedClp_N; Clp amino terminal domain, pathogenicity island component (PF02861; HMM-score: 15)
    GD_AH_C; D-galactarate dehydratase / Altronate hydrolase, C terminus (PF04295; HMM-score: 12.5)
    Arginase (CL0302) Hist_deacetyl; Histone deacetylase domain (PF00850; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS0201530S ribosomal protein S6  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS0294530S ribosomal protein S12  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02985UDP-glucose 4-epimerase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS04710hypothetical protein  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS070652-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS10845DEAD/DEAH box family ATP-dependent RNA helicase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS11635DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1168550S ribosomal protein L18  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS1176550S ribosomal protein L3  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.163
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 30
    • Smax: 0.369
    • Smax_pos: 2
    • Smean: 0.249
    • D: 0.196
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446954153 NCBI
  • RefSeq: WP_001031409 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKEQLEKMKNGKGFIAALDQSGGSTPKALKEYGVNEDQYSNEDEMFQLVHDMRTRVVTSPSFSPDKILGAILFEQTMDREVEGKYTADYLADKGVVPFLKVDKGLAEEQNGVQLMKPIDNLDSLLDRANERHIFGTKMRSNILELNEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAEIEKVLKAELKKGLDSLNADQLVMLKLTIPTEPNLYKELAEHPNVVRVVVLSGGYSREKANELLKDNDELIASFSRALASDLRADQSKEEFDKALGDAVESIYDASVNKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS13730 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]