From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000414 [new locus tag: EGJ38_RS02065 ]
  • pan locus tag?: SAUPAN002199000
  • symbol: EGJ38_000414
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000414
  • product: YbaB/EbfC family nucleoid-associated protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000414 [new locus tag: EGJ38_RS02065 ]
  • symbol: EGJ38_000414
  • product: YbaB/EbfC family nucleoid-associated protein
  • replicon: chromosome
  • strand: +
  • coordinates: 446186..446503
  • length: 318
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422413 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCGCGGTGGCGGAAACATGCAACAAATGATGAAACAAATGCAAAAAATGCAAAAGAAA
    ATGGCTCAAGAACAAGAAAAACTTAAAGAAGAGCGTATTGTAGGAACAGCTGGCGGTGGC
    ATGGTTGCAGTTACTGTAACTGGTCATAAAGAAGTTGTCGACGTTGAAATCAAAGAAGAA
    GCTGTAGACCCAGATGATATTGAAATGCTACAAGACTTAGTGTTAGCAGCTACTAATGAA
    GCGATGAATAAAGCTGATGAGCTTACTCAAGAACGTTTAGGTAAACATACTCAAGGCTTA
    AACATCCCTGGAATGTGA
    60
    120
    180
    240
    300
    318

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000414 [new locus tag: EGJ38_RS02065 ]
  • symbol: EGJ38_000414
  • description: YbaB/EbfC family nucleoid-associated protein
  • length: 105
  • theoretical pI: 4.74462
  • theoretical MW: 11597.3
  • GRAVY: -0.619048

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General DNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 100.9)
    and 4 more
    Metabolism Central intermediary metabolism Phosphorus compounds exopolyphosphatase (TIGR03706; EC 3.6.1.11; HMM-score: 16.5)
    Unknown function General alpha-NAC homolog (TIGR00264; HMM-score: 9.2)
    Cellular processes Cellular processes DNA transformation Bacteroides conjugative transposon TraJ protein (TIGR03782; HMM-score: 8.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 7.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    YbaB (CL0717) YbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 115.9)
    and 10 more
    no clan defined DUF2931; Protein of unknown function (DUF2931) (PF11153; HMM-score: 19.7)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 17.7)
    GADPH_aa-bio_dh (CL0139) Semialdhyde_dhC; Semialdehyde dehydrogenase, dimerisation domain (PF02774; HMM-score: 14.6)
    no clan defined GIT_CC; GIT coiled-coil Rho guanine nucleotide exchange factor (PF16559; HMM-score: 14.5)
    Glutaminase_I (CL0014) Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 13.7)
    no clan defined DUF863; Plant protein of unknown function (DUF863) (PF05904; HMM-score: 12.6)
    FKBP_N; Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346; HMM-score: 11.8)
    DNA-mend (CL0382) Integrase_1; Integrase (PF12835; HMM-score: 11.1)
    PH (CL0266) SPT16; FACT complex subunit (SPT16/CDC68) (PF08644; HMM-score: 10.3)
    RND_permease (CL0322) MMPL; MMPL family (PF03176; HMM-score: 9.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9968
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0026
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014356
    • TAT(Tat/SPI): 0.003446
    • LIPO(Sec/SPII): 0.001334
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422413 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]