Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
- pan locus tag?: SAUPAN002199000
- symbol: SACOL0521
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
- symbol: SACOL0521
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 527373..527690
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237096 NCBI
- RefSeq: YP_185409 NCBI
- BioCyc: see SACOL_RS02640
- MicrobesOnline: 911990 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCGCGGTGGCGGAAACATGCAACAAATGATGAAACAAATGCAAAAAATGCAAAAGAAA
ATGGCTCAAGAACAAGAAAAACTTAAAGAAGAGCGTATTGTAGGAACAGCTGGCGGTGGC
ATGGTTGCAGTTACTGTAACTGGTCATAAAGAAGTTGTCGACGTTGAAATCAAAGAAGAA
GCTGTAGACCCAGACGATATTGAAATGCTACAAGACTTAGTGTTAGCAGCTACTAATGAA
GCGATGAATAAAGCTGATGAGCTTACTCAAGAACGTTTAGGTAAACATACTCAAGGCTTA
AACATCCCTGGAATGTGA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
- symbol: SACOL0521
- description: hypothetical protein
- length: 105
- theoretical pI: 4.74462
- theoretical MW: 11597.3
- GRAVY: -0.619048
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General DNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 100.9)and 4 moreCentral intermediary metabolism Phosphorus compounds exopolyphosphatase (TIGR03706; EC 3.6.1.11; HMM-score: 16.5)Unknown function General alpha-NAC homolog (TIGR00264; HMM-score: 9.2)Cellular processes DNA transformation Bacteroides conjugative transposon TraJ protein (TIGR03782; HMM-score: 8.9)Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 7.9)
- TheSEED :
- Nucleoid-associated protein YaaK
DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway FIG000557: hypothetical protein co-occurring with RecRand 1 more - PFAM: YbaB (CL0717) YbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 115.9)and 10 moreno clan defined DUF2931; Protein of unknown function (DUF2931) (PF11153; HMM-score: 19.7)YajC; Preprotein translocase subunit (PF02699; HMM-score: 17.7)GADPH_aa-bio_dh (CL0139) Semialdhyde_dhC; Semialdehyde dehydrogenase, dimerisation domain (PF02774; HMM-score: 14.6)no clan defined GIT_CC; GIT coiled-coil Rho guanine nucleotide exchange factor (PF16559; HMM-score: 14.5)Glutaminase_I (CL0014) Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 13.7)no clan defined DUF863; Plant protein of unknown function (DUF863) (PF05904; HMM-score: 12.6)FKBP_N; Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346; HMM-score: 11.8)DNA-mend (CL0382) Integrase_1; Integrase (PF12835; HMM-score: 11.1)PH (CL0266) SPT16; FACT complex subunit (SPT16/CDC68) (PF08644; HMM-score: 10.3)RND_permease (CL0322) MMPL; MMPL family (PF03176; HMM-score: 9.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9968
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0026
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014356
- TAT(Tat/SPI): 0.003446
- LIPO(Sec/SPII): 0.001334
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 789 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 41.01 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
