Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0453 [new locus tag: SAUSA300_RS02425 ]
- pan locus tag?: SAUPAN002199000
- symbol: SAUSA300_0453
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0453 [new locus tag: SAUSA300_RS02425 ]
- symbol: SAUSA300_0453
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 511117..511434
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913789 NCBI
- RefSeq: YP_493165 NCBI
- BioCyc: GH3C-448 BioCyc
- MicrobesOnline: 1291968 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCGCGGTGGCGGAAACATGCAACAAATGATGAAACAAATGCAAAAAATGCAAAAGAAA
ATGGCTCAAGAACAAGAAAAACTTAAAGAAGAGCGTATTGTAGGAACAGCTGGCGGTGGC
ATGGTTGCAGTTACTGTAACTGGTCATAAAGAAGTTGTCGACGTTGAAATCAAAGAAGAA
GCTGTAGACCCAGACGATATTGAAATGCTACAAGACTTAGTGTTAGCAGCTACTAATGAA
GCGATGAATAAAGCTGATGAGCTTACTCAAGAACGTTTAGGTAAACATACTCAAGGCTTA
AACATCCCTGGAATGTGA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0453 [new locus tag: SAUSA300_RS02425 ]
- symbol: SAUSA300_0453
- description: hypothetical protein
- length: 105
- theoretical pI: 4.74462
- theoretical MW: 11597.3
- GRAVY: -0.619048
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General DNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 100.9)and 4 moreCentral intermediary metabolism Phosphorus compounds exopolyphosphatase (TIGR03706; EC 3.6.1.11; HMM-score: 16.5)Unknown function General alpha-NAC homolog (TIGR00264; HMM-score: 9.2)Cellular processes DNA transformation Bacteroides conjugative transposon TraJ protein (TIGR03782; HMM-score: 8.9)Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 7.9)
- TheSEED: DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway FIG000557: hypothetical protein co-occurring with RecRand 1 more
- PFAM: no clan defined YbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 111.6)and 9 moreDUF2931; Protein of unknown function (DUF2931) (PF11153; HMM-score: 19.5)YajC; Preprotein translocase subunit (PF02699; HMM-score: 18.6)GIT_CC; GIT coiled-coil Rho guanine nucleotide exchange factor (PF16559; HMM-score: 15.1)FKBP_N; Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346; HMM-score: 14.5)GADPH_aa-bio_dh (CL0139) Semialdhyde_dhC; Semialdehyde dehydrogenase, dimerisation domain (PF02774; HMM-score: 14.4)Glutaminase_I (CL0014) Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 13.6)no clan defined DUF2935; Domain of unknown function (DUF2935) (PF11155; HMM-score: 13.2)DUF863; Plant protein of unknown function (DUF863) (PF05904; HMM-score: 11.9)Oxa1 (CL0376) 60KD_IMP; 60Kd inner membrane protein (PF02096; HMM-score: 6.7)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014356
- TAT(Tat/SPI): 0.003446
- LIPO(Sec/SPII): 0.001334
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]